SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013743 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013743
Domain Number 1 Region: 15-250
Classification Level Classification E-value
Superfamily L domain-like 3.74e-43
Family Ngr ectodomain-like 0.0088
Further Details:      
 
Domain Number 2 Region: 264-353
Classification Level Classification E-value
Superfamily Immunoglobulin 6.9e-18
Family I set domains 0.038
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000013743
Domain Number - Region: 369-454
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00161
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013743   Gene: ENSMMUG00000010487   Transcript: ENSMMUT00000014671
Sequence length 552
Comment pep:known_by_projection chromosome:MMUL_1:1:165804453:165806425:1 gene:ENSMMUG00000010487 transcript:ENSMMUT00000014671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNLLGRVACHGNLLLRAIDSRWFEMLPNLEILMIGGNKVDAILDMNFRPLANLRSLVLA
GMNLREISDYALEGLQSLESLSFYDNQLARVPRRALEQVPGLKFLDLNKNPLQRVGPGDF
ANMLHLKELGLNNMEELVSIDKFALVNLPELTKLDITNNPRLSFIHPRAFHHLPQMETLM
LNNNALSALHQQTVESLPNLQEVGLHGNPIRCDCVIRWANATGTRVRFIEPQSTLCAEPP
DLQRRPVREVPFREMTDHCLPLISPRSFPPSLQVASGESMVLHCRALAEPEPEIYWVTPA
GFRLTPAHAGRRYRVYPEGTLELRRVTAEEAGLYTCVAQNLVGADTKTVSVVVGRALLQP
GRDEGRGLELRVQETHPYHILLSWVTPPNTVSTNLTWSSASSLRGQGATALARLPRGTHS
YNITRLLQATEYWACLQVAFADAHTQLACVWARTKEATSCHRALGDRPGLIAILALAVLL
LAAGLAAHLGTGQPRKGVGGRQPLPPAWAFWGWSAPSVRVVSAPLVLPWNPGRKLPSSSE
GETLSPPLSQNS
Download sequence
Identical sequences ENSMMUP00000013743 9544.ENSMMUP00000013743 ENSMMUP00000013743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]