SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013828 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013828
Domain Number 1 Region: 261-319
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000018
Family BSTI 0.049
Further Details:      
 
Domain Number 2 Region: 626-688
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000563
Family BSTI 0.067
Further Details:      
 
Domain Number 3 Region: 728-789
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000157
Family ATI-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013828   Gene: ENSMMUG00000010544   Transcript: ENSMMUT00000014760
Sequence length 2284
Comment pep:known_by_projection chromosome:MMUL_1:14:1038935:1059568:1 gene:ENSMMUG00000010544 transcript:ENSMMUT00000014760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALNPAHNGRVCSTWGDFHYKTFDGDVFRFPGLCNYVFSEHCGAAYEDFNVQLRRGLVGSR
PVVTRVVIKAQGLVLEASNGSVLVNGQREELPYSRTGLLVEQSGDYVKVSIRLVLTFLWN
GEDSALLELDPKYANQTCGLCGDFNGLPAFNEFYAHNARLTPLQFGNLQKLDGPTEQCPD
PLPLPASNCTDEEGICHHTLLGPAFAECHALVDTAPYLAACAQDLCRCPTCPCATFVEYS
RQCAHAGGQPQNWRRPELCPRTCPVNMQHRECGSPCVDTCSNPQHAQLCEDHCVDGCFCP
PGTVLDDVTHSGCLPLGQCPCTHGGRTYSPGASVNTTCSSCTCSGGLWQCQDLPCPGTCS
VQGGAHITTYDEKLYDLHGDCSYVLSKKCADGSFTVLAELRKCGLTDNENCLKAVTLSLD
GGDTAIRVQADGSVFLNSIYTQLPLSAANITLFTPSSFFIVVHTGLGLQLLVQLVPLMQV
FVRLDPAHQGQMCGLCGNFNQNQADDFAALSGVVEATGAAFANTWKAQATCTSARNSFED
PCSLSVENENYARHWCSRLTDPTGSFSRCHSVINPKPFHSNCLFDTCNCERSEDCLCAAL
SSYVHACAAKGVQLSGWRDGVCTKYMQNCPKSQSYAYVVDACQPTCRGLSEADVTCSVSF
VPVDGCTCPTGTFLNDAGACVPARECPCYVHGTVLAPGEVVHDEGAVCSCEGGKLSCLGA
SLQKSTGCVAPMVYLNCSNSLAGTPGAECLRSCHTLDVGCFSTHCVSGCVCPPGLVSDGS
GGCIAEEDCPCVHNEATYKPGDTIRVDCNTWWVVGPRDTHPSKGGPELPERKSHWPGHSL
HMARGAEDHSGSGRLGWIGSRVGWSRPTAASAAPVRPQRSQAAPVPSTSWPASCQTSAEG
LVDSYELILQEGAFKAVARGPGGDPPYKIRYMGIFLVIETRGMAVSWDRKTSVFIRLHQD
YKGRVCGLCGNFDDHAINDFATRSRSVVGDALEFGNSWKLSPSCPDALAPKDPCTANPFR
KSWAQKQCSILHGPTFAACRSQVDSTKYYEACVNDACACDSGGDCECFCTAVAAYAQACH
DAGLCVSWRTPDTCPLFCDFYNPHGGCEWHYQPCGAPCLKTCRNPSGHCLVDLPGLEGEG
NLSWMEPPILGVPSVCGGPGFPRNCTMQALGAGPCWLVGGGIQCAHSLEACTCTYEDRTY
GYQDVIYNTTDGLGACLIAICGSNGTIVRKAVACPGTPATTPFTFTTSWVPHSTTRVHSP
HNTLRVFRGSPTPSHPSAWPIPAGRLPQGPALPVSTVCVREVCRWSSWYNGHHPEPGLGG
GDFETFENLRQRGYQVCPVPADIECRAGQLPDMPLGELGQQVDCDRVRGLMCANSQQSPP
LCHDYELRVLCCEYVPCGPSLAPGTSPQPSLSASTEPAVPTPTQTTATEQTTLWVIPSIR
STAALTSQTGSTAGGHLCEQPKDIECQAESFPNWPLAQVGQKVHCDVRFGLVCRNWEQEG
IFKMCYNYRIRVLCCSADHCRPPTPAPTTMATSRAHLTGTASSSSKQPLTTSLAPTLSSE
LFTSQAETSTPRTETTLSRLTETTTSQSTTRCQPKCEWTEWFDVDFPTSGVAGGDMETFE
NIRAAGGKMCWAPKSIECRAENYPEVSIDQIGQVLTCSLETGLICKNEDQTGRFNMCFNY
NVRVLCCDDYSHCPHTAAPTPTSSTQAPRLTSMGATSPTVTASTAIATWSTKSPAVTGSS
TLATTQTGPSFSKTTERVSLPSPSAPLPSTASLLPTREQQTSQAPSMPTSPTPSPSTGCV
PRCTWTDWFDEDYPSSDPDGGDFETFGVIRAGHTFCEHPWDIECRSEKEPNQPLEALGQV
VQCDVSIGLVCRNRDQSGPLWYCHNFHVRLLCCDDSHCASTPTSTGSTATTPTSTGSTAT
TPTSTGSTATTPMSTRSTATTPTSTGSPTSAPTTPVVSTGCEPQCAWSDWLDYSYPMSGP
SGGDLETYSNIRAAGGAVCEQPLGLECRAQAQPGVPLRELGQVVECSLDFGLVCRNRQQV
GKFKMCFNYEIRVFCCATPSSTPASTWILTEPTTTAVTTVATGSTAMPSSTQGTTGSLTE
PTNTATITVTTSSTAMPSSTPGMTSILTEPTTTAITTVATRSTATPSSTPETARIVTEPT
TTATITVATSSTATPSSTPEPTTTAITTVAPGSTATPTSTLGTTGILTEPTTTTITTVAT
RSTATHSSTPGTTGILTELTTTAITTVAPGSTATPSSTPGTTGILTEPTTTATITVATGS
TAIP
Download sequence
Identical sequences ENSMMUP00000013828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]