SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013831 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013831
Domain Number 1 Region: 240-298
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000000719
Family BSTI 0.049
Further Details:      
 
Domain Number 2 Region: 605-667
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000288
Family BSTI 0.067
Further Details:      
 
Domain Number 3 Region: 707-768
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000759
Family ATI-like 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000013831
Domain Number - Region: 1073-1100
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0602
Family ATI-like 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013831   Gene: ENSMMUG00000010544   Transcript: ENSMMUT00000014763
Sequence length 1254
Comment pep:known_by_projection chromosome:MMUL_1:14:1038935:1053382:1 gene:ENSMMUG00000010544 transcript:ENSMMUT00000014763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALNPAHNGRVCSTWGDFHYKTFDGDVFRFPGLCNYVFSEHCGAAYEDFNPATQRPGGLQA
CGHPCCHQGPGAGARGVQWLCPRQRAAGGAALQPHWAPGGAEWGLRQAGAGPQIRQPDLW
PVRGLQRPPSLQRVLCPQCQTDPAPVWEPAEWMGPRSSARTRCPCQPATAQEGICHHTLL
GPAFAECHALVDTAPYLAACAQDLCRCPTCPCATFVEYSRQCAHAGGQPQNWRRPELCPR
TCPVNMQHRECGSPCVDTCSNPQHAQLCEDHCVDGCFCPPGTVLDDVTHSGCLPLGQCPC
THGGRTYSPGASVNTTCSSCTCSGGLWQCQDLPCPGTCSVQGGAHITTYDEKLYDLHGDC
SYVLSKKCADGSFTVLAELRKCGLTDNENCLKAVTLSLDGGDTAIRVQADGSVFLNSIYT
QLPLSAANITLFTPSSFFIVVHTGLGLQLLVQLVPLMQVFVRLDPAHQGQMCGLCGNFNQ
NQADDFAALSGVVEATGAAFANTWKAQATCTSARNSFEDPCSLSVENENYARHWCSRLTD
PTGSFSRCHSVINPKPFHSNCLFDTCNCERSEDCLCAALSSYVHACAAKGVQLSGWRDGV
CTKYMQNCPKSQSYAYVVDACQPTCRGLSEADVTCSVSFVPVDGCTCPTGTFLNDAGACV
PARECPCYVHGTVLAPGEVVHDEGAVCSCEGGKLSCLGASLQKSTGCVAPMVYLNCSNSL
AGTPGAECLRSCHTLDVGCFSTHCVSGCVCPPGLVSDGSGGCIAEEDCPCVHNEATYKPG
DTIRVDCNTWWVVGPTPTPAKGGQSSPRERATGRDTPCTWREGLRTTADRGGWCEVVGAG
PSVPRQPLFPALPGQPLAKPPLRVSWTQSYELILQEGAFKAVARGPGGDPPYKIRYMGIF
LVIETRGMAVSWDRKTSVFIRLHQDYKGRVCGLCGNFDDHAINDFATRSRSVVGDALEFG
NSWKLSPSCPDALAPKDPCTANPFRKSWAQKQCSILHGPTFAACRSQVDSTKYYEACVND
ACACDSGGDCECFCTAVAAYAQACHDAGLCVSWRTPDTCPLFCDFYNPHGGCEWHYQPCG
APCLKTCRNPSGHCLVDLPGLEGEGNLSWMEPPILGVPSVCGGPGFPRNCTMQALGAGPC
WLVGGGIQCAHSLEACTCTYEDRTYGYQDVIYNTTDGLGACLIAICGSNGTIVRKAVACP
GTPATTPFTFTTSWVPHSTTRVHSPHNTLRVFRGSPTPSHPSAWPIPAGRLPQG
Download sequence
Identical sequences ENSMMUP00000013831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]