SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013887 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013887
Domain Number 1 Region: 187-269
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-21
Family SH3-domain 0.0001
Further Details:      
 
Domain Number 2 Region: 2-30
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000332
Family LASP-1 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000013887
Domain Number - Region: 32-59
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000438
Family LIM domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013887   Gene: ENSMMUG00000010589   Transcript: ENSMMUT00000014822
Sequence length 270
Comment pep:known chromosome:MMUL_1:9:21015935:21396874:-1 gene:ENSMMUG00000010589 transcript:ENSMMUT00000014822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPQCARCGKVVYPTEKVNCLDKYWHKGCFHCEVCKMALNMNNYKGYEKKPYCNAHYPKQ
SFTTVADTPENLRLKQQSELQSQVKYKRDFEESKGRGFSIVTDTPELQRLKRTQEQISNV
KYHEDFEKTKGRGFTPVVDDPVTERVRKNTQVVSDAAYKGVHPHIVEMDRRPGIIVAPVL
PGAYQQSHSQGYGYMHQTSVSSMRSMQHSPNLRTYRAMYDYSAQDEDEVSFRDGDYIVNV
QPIDDGWMYGTVQRTGRTGMLPANYIEFVN
Download sequence
Identical sequences A0A1D5RAK7 A0A2I3FXH0 A0A2I3TGT5 A0A2J8RVW7 A0A2K5CX77 A0A2K5J026 A0A2K5M6V8 A0A2K5PCW0 A0A2K5TRL9 A0A2K6BYR8 A0A2K6N6Q5 A0A2K6PT29 U3C6Z0
gi|47087157|ref|NP_998734.1| ENSP00000393896 NP_998734.1.87134 NP_998734.1.92137 XP_005564827.1.63531 XP_008000643.1.81039 XP_009243441.1.23681 XP_010365887.1.97406 XP_011736807.1.29376 XP_011819250.1.43180 XP_011911324.1.92194 XP_012355015.1.23891 XP_015002068.1.72884 XP_016818231.1.37143 XP_017367408.1.71028 XP_021522515.1.9421 ENSP00000393896 ENSMMUP00000013887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]