SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013895 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013895
Domain Number 1 Region: 51-244
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.74e-75
Family T-box 0.000000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013895   Gene: ENSMMUG00000010599   Transcript: ENSMMUT00000014830
Sequence length 301
Comment pep:known chromosome:MMUL_1:4:80706558:80777849:-1 gene:ENSMMUG00000010599 transcript:ENSMMUT00000014830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IWKLGFPEGGCEDGFQQGASPLASPGGSPKGSPAPSLARPGTPLPSPQAPRVDLQGAELW
KRFHEIGTEMIITKAGRRMFPAMRVKISGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWM
VAGNADSPVPPRVYIHPDSPASGETWMRQVISFDKLKLTNNELDDQGHIILHSMHKYQPR
VHVIRKDCGDDLSPIKPVPSGEGVKAFSFPETVFTTVTAYQNQQITRLKIDRNPFAKGFR
DSGRNRMGLEALVESYAFWRPSLRTLTFEDIPGIPKQEYRDLKTDYIFPKRDNLVSRETK
L
Download sequence
Identical sequences ENSMMUP00000013895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]