SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013901 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013901
Domain Number 1 Region: 6-71
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000319
Family VWC domain 0.032
Further Details:      
 
Domain Number 2 Region: 100-145
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013901   Gene: ENSMMUG00000010605   Transcript: ENSMMUT00000014836
Sequence length 158
Comment pep:known_by_projection chromosome:MMUL_1:10:19711528:19714103:-1 gene:ENSMMUG00000010605 transcript:ENSMMUT00000014836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAEDDGSCEVNGRLYQEGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPYPRRVE
VLGKCCPEWVCGQGGGLGAQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGM
ATRVTNQNRFCRLETQRRLCLSRPCPPSRGRSPRNSAF
Download sequence
Identical sequences ENSMMUP00000013901 ENSMMUP00000013901 9544.ENSMMUP00000013901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]