SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013971 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013971
Domain Number 1 Region: 813-1100
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-78
Family Protein kinases, catalytic subunit 0.000000000339
Further Details:      
 
Domain Number 2 Region: 539-718
Classification Level Classification E-value
Superfamily Fibronectin type III 2.97e-27
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 3 Region: 426-569
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000547
Family Fibronectin type III 0.0056
Further Details:      
 
Domain Number 4 Region: 334-432
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000189
Family I set domains 0.035
Further Details:      
 
Domain Number 5 Region: 115-195
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000156
Family I set domains 0.07
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000013971
Domain Number - Region: 299-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000299
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 207-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0703
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013971   Gene: ENSMMUG00000010660   Transcript: ENSMMUT00000014912
Sequence length 1119
Comment pep:known chromosome:MMUL_1:1:46218092:46236480:1 gene:ENSMMUG00000010660 transcript:ENSMMUT00000014912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAAVDLTLLANLRFTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIVRTPPGQTLR
LARNGSHQVTLHGFSKPSDLVGVFSCVGGSGTRRTRVIYVHNSPGAHLLPDKVTHTVNKG
DTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGQFLLQLPDVQPPSSGIYSATYLE
ASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQAC
REGRFGQSCQEQCPGISGCRGLTFCLPDPYGCSCGSGWRGSQCQEACTPGHFGADCRLQC
QCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASELEFNLETMPRINCAAAGNPF
PVRGSIELRKPDGTVLLSTKAIVEPDKTTAEFEVPRLVLADSGFWECRVSTSGGQDSRRF
KVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFSGDGPISSVRLHYRPQDSTMDWSTIVVD
PSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTTDCPEPLLQPWLEGWHVEGP
DRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLD
VQLYHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEIQLTWQHPEALPGPISKYVV
EVQVAGGAGEPLWIDVDRPEETSTIIRGLNASTRYLFRVRAGIQGLGDWSNTVEESTLGN
GLQAEGPVQESRAAEEGLDQQLILAVVGSVSATCLTILAALLTLVCIRRSCLHRRRTFTY
QSGSGEETILQFSSGTLTLTRRPKPQPEPLSYPVLEWEDITFEDLIGEGNFGQVIRAMIK
KDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNIINLLGACKNRGYLYIAIEY
APYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIHRD
LAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSF
GVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMRQCWRDRPYERPP
FAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA
Download sequence
Identical sequences 9544.ENSMMUP00000013971 ENSMMUP00000013971 ENSMMUP00000013971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]