SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013992 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013992
Domain Number 1 Region: 25-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.7e-19
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013992   Gene: ENSMMUG00000010679   Transcript: ENSMMUT00000014934
Sequence length 202
Comment pep:known_by_projection chromosome:MMUL_1:9:100592322:100598423:-1 gene:ENSMMUG00000010679 transcript:ENSMMUT00000014934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPG
VVIYVNSRPCCVPRVVAEYLNGSVREESIHCKSVEEISTLVQKLANQSGLDVIRIRKPFH
TDNPSIQGQWHPFTNKPTTFRELCPREVQDPAPAQDTGLRLSAVARQILLPGWPDPISAQ
SSDLPWGNTHYVPEPLSSATWL
Download sequence
Identical sequences A0A1D5QKQ0
ENSMMUP00000013992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]