SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014006 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014006
Domain Number 1 Region: 2370-2442
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.05e-19
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 2 Region: 994-1063
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.59e-19
Family TB module/8-cys domain 0.00065
Further Details:      
 
Domain Number 3 Region: 1727-1798
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.28e-18
Family TB module/8-cys domain 0.00043
Further Details:      
 
Domain Number 4 Region: 2085-2156
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.44e-18
Family TB module/8-cys domain 0.0000985
Further Details:      
 
Domain Number 5 Region: 355-421
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.62e-18
Family TB module/8-cys domain 0.0018
Further Details:      
 
Domain Number 6 Region: 578-699
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.02e-18
Family Growth factor receptor domain 0.0062
Further Details:      
 
Domain Number 7 Region: 756-898
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 8 Region: 1882-2008
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.92e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 9 Region: 2485-2613
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.02e-17
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 2163-2297
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.18e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 209-294
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.1e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 12 Region: 889-973
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.67e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 13 Region: 1567-1640
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000196
Family TB module/8-cys domain 0.0000464
Further Details:      
 
Domain Number 14 Region: 694-766
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000249
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 15 Region: 1198-1336
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000345
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 16 Region: 1451-1577
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000113
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 17 Region: 1357-1490
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000973
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 18 Region: 2610-2726
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000022
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 19 Region: 1070-1200
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000282
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 20 Region: 1648-1732,1827-1884
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000581
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 21 Region: 2445-2490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000437
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 22 Region: 2046-2099
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000161
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 23 Region: 250-367
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000033
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 24 Region: 493-586
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000377
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 25 Region: 2323-2372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000532
Family EGF-type module 0.008
Further Details:      
 
Domain Number 26 Region: 2001-2042
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000719
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 27 Region: 2286-2328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000794
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000014006
Domain Number - Region: 2819-2865
Classification Level Classification E-value
Superfamily Cadherin-like 0.00303
Family Cadherin 0.015
Further Details:      
 
Domain Number - Region: 180-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00321
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 146-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0726
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014006   Gene: ENSMMUG00000010682   Transcript: ENSMMUT00000014950
Sequence length 2904
Comment pep:known_by_projection chromosome:MMUL_1:6:124666708:124935086:-1 gene:ENSMMUG00000010682 transcript:ENSMMUT00000014950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRRRLCLQPYFLWLGCVALWAQGTAGQPQPPPPKPPRPQPPPQQVRSATTGSEGGFLA
PEYREEGAAVASRVRRRGQQDVLRGPNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCG
DGFCSRPNMCTCSSGQISPTCGSKSIQQCSVRCMNGGTCADDHCQCQKGYIGAYCGQPVC
ENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCC
ATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFE
CRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRCID
QRTGMCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDG
LPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGG
QGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECT
SNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQC
ICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVD
ECQTPGICMNGHCINNEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFP
GAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICA
NGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPG
YVFRTETETCEDINECESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWL
NIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECE
VFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKF
RMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAF
PGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFEC
ECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD
INECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNS
EGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDM
KTCIDVNECDLNSNICMFGEFRLPFSPYSCIFTLKCYLYKNISGNVDECEIGAHNCDMHA
SCLNIPGSFKCSCREGWIGNGIKCIDLDECSNGTHQCSINAQCVNTPGSYRCACSEGFTG
DGFTCSDVDECAENINLCENGQCLNVPGAYRCECEMGFTPASDSRSCQDIDECSFQNICV
FGTCNNLPGMFHCICDDGYELDRTGGNCTDIDECADPINCVNGLCVNTPGRYECNCPPDF
QLNPTGVGCVDNRVGNCYLKFGPRGDGSLSCNTEIGVGVSRSSCCCSLGKAWGNPCETCP
PVNSTEYYTLCPGGEGFRPNPITIILEDIDECQELPGLCQGGNCINTFGSFQCECPQGYY
LSEETRICEDIDECFAHPGVCGPGTCYNTLGNYTCICPPEYMQVNGGHNCMDMRKSFCYR
SYNGTTCENELPFNVTKRMCCCTYNVGKAWNKPCEPCPTPGTADFKTICGNIPGFTFDIH
TGKAVGEFFQIMFVLIHTCIILLQFRCCPTGFSYNDLLVCEDIDECSNGDNLCQRNADCI
NSPGSYRCECAAGFKLSPNGACVDRNECLEIPNVCSHGLCVDLQGSYQCICHNGFKASQD
QTMCMDVDECERHPCGNGTCKNTVGSYNCLCYPGFELTHNNDCLDIDECSSFFGQVCRNG
RCFNEIGSFKCLCNEGYELTPDGKNCIDTNECVALPGSCSPGTCQNLEGSFRCICPPGYE
VKSENCIDINECDEDPNICLFGSCTNTPGGFQCLCPPGFVLSDNGRRCFDTRQSFCFTNF
ENGKCSVPKAFNTTKAKCCCSKMPGEGWGDPCELCPKDDEVAFQDLCPYGHGTVPSLHDT
REDVNECLESPGICSNGQCVNTDGSFRCECPMGYNLDYTGVRCVDTDECSIGNPCGNGTC
TNVIGSFECNCNEGFEPGPMMNSDNINECAQNPLLCAFRCMNTFGSYECTCPIGYALRED
QKMCKDLDECAEGLHDCESRGMMCKNLIGTFMCICPPGMARRPDGEGCVDENECRTKPGI
CENGRCVNIIGSYRCECNEGFQSSSSGTECLDNRQGLCFAEVLQTICQMASSSRNLVTKS
ECCCDGGRGWGHQCELCPLPGTAQYKKICPHGPGYTTDGRDIDECKVMPNLCTNGQCINT
MGSFRCFCKVGYTTDISGTSCIDLDECSQSPKPCNFICKNTEGSYQCSCPRGYVLQEDGK
TCKDLDECQTKQHNCQFLCVNTLGGFTCKCPPGFTQHHTACIDNNECGSQPSLCGAKGIC
QNTPGSFSCECQRGFSLDATGLNCEDVDECDGNHRCQHGCQNILGGYRCGCPQGYIQHYQ
WNQCVDENECSNPNACGSASCYNTLGSYKCACPSGFSFDQFSSACHDVNECSSSKNPCNY
GCSNTEGGYLCGCPPGYYRVGQGHCVSGMGFNKGQYLSLDTEVDEENALSPEACYECKIN
GYSKKDSRQKRSVHEPDPTAVEQISLESVDMDSPVNMKFNLSHLGSKEHILELRPAIQPL
NNHIRYVISQGNDDGIFRIHQRNGLSYLHTAKKKLMPGTYTLEITSVPLYKKKELKKLEE
SNEDDYLLGELGEALRMRLQIQLY
Download sequence
Identical sequences ENSMMUP00000014006 9544.ENSMMUP00000014006 ENSMMUP00000014006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]