SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014052 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014052
Domain Number 1 Region: 1043-1211
Classification Level Classification E-value
Superfamily C-type lectin-like 8.57e-44
Family C-type lectin domain 0.00000528
Further Details:      
 
Domain Number 2 Region: 150-267
Classification Level Classification E-value
Superfamily C-type lectin-like 9.89e-37
Family Link domain 0.0015
Further Details:      
 
Domain Number 3 Region: 268-363
Classification Level Classification E-value
Superfamily C-type lectin-like 4.05e-28
Family Link domain 0.0036
Further Details:      
 
Domain Number 4 Region: 44-157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000131
Family V set domains (antibody variable domain-like) 0.024
Further Details:      
 
Domain Number 5 Region: 1008-1049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000252
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014052   Gene: ENSMMUG00000010724   Transcript: ENSMMUT00000014997
Sequence length 1320
Comment pep:known_by_projection chromosome:MMUL_1:19:18866844:18901523:1 gene:ENSMMUG00000010724 transcript:ENSMMUT00000014997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGATFVWALGLLMPQMLLFVAGEQGTQDIADASERGLHMQKLGSGSVRAALAELVALPCL
FTLQPRPSAARDAPRIKWTKVRTASGQRQDLPILVAKDNVVRVAKSWQGRVSLPAYPRRR
VNATLLLGPLRASDSGLYRCQVVRGIEDEQDLVPLEVTGVVFHYRAAQDRYALTFAEAQE
ACHLSSAIIAAPRHLQAAFEDGFDNCDAGWLSDRTVRYPITQSRPGCYGDRSSLPGVRSY
GRRNPQELYDVYCFARELGGEVFYVGPARRLTLAGARAQCRRQGAALASVGQLHLAWHEG
LDQCDPGWLADGSVRYPIQTPRRRCGGPAPGVRTVYRFANRTGFPSPAARFDAYCFRAHH
PTSQHGDLETPSSGDEGEILSAEGPPVRELEPTLEEEEVVTPDFQEPLVSSGEEEPLILA
EKQESQQTLSPTPGNPMLASWPTGEVWLSTVAPSPSDTGAGTTASSHTEVAPTDPTARRR
GRFKGLNGRYFQQQDPEPGLQEGMEASAQPPTSEAVGNQVEPPLAMAVTEMWGSGHSRSP
WADLTNEVDMPRAGSAGGKSSPEPWLWPPTMVPPSISGHSRAPVPELEKAEGPSARPATP
DLFWSPLEATVSAPSPAPWEASPLATSPDLPMMAMLRGPKQWMLPHPTSVSTEASRVEGH
GEATATAPPSPAAETEVYSLPPFSTPTGQGGEAMPTTPESPRADFREIGETGLAQVHKAE
HPSSSPWPSVNRNVAVGFVPTETATELTGLRGISGSESGVFDTAESPTSGLQATVDEVQD
PWPSVYSKGPGASSPSAPSGTPGVFLVPKVTPSLEPWVATDEGPTVNPKDSTVTPAPSDA
SGIWEPGSQSFEEAESTTLSPQVALDTSVVTSLTTEQGDKVGVPAMSTLASSSSQSHPEP
EDQVETQGTSGTSAPPHQSSPLGKPAVPPGTPTAASVGESALVSSGEPTVPWDPSSTLLP
VTLGIEDFKLEVLAGSPGVESFWEEVASGEEPALSGTPTNEGAEEAHSDPCENNPCLHGG
TCNANGTMYGCSCDQGFAGENCEIDIDDCLCSPCENGGTCIDEVNGFVCLCLPSYGGSLC
EKDTEGCDRGWHKFQGHCYRYFAHRRAWEDAERDCRRRSGHLTSVHSPEEHSFINSFGHE
NTWIGLNDRIVERDFQWTDNTGLQFENWRENQPDNFFAGGEDCVVMVAHESGRWNDVPCN
YNLPYVCKKGTGMRDPPASASRSRLVFARGQGSGEEGVTSAQWIQNFGVHSVIQAGVHLT
SSWDYPPILASQTRRSHRMRRHHHHHQHHHQHHHHKSHKERRKHKKHPMEDWEKDEGNFC
Download sequence
Identical sequences 9544.ENSMMUP00000014052 ENSMMUP00000014052 ENSMMUP00000014052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]