SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014199 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014199
Domain Number 1 Region: 6-187
Classification Level Classification E-value
Superfamily p53-like transcription factors 8.08e-76
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000401
Further Details:      
 
Domain Number 2 Region: 182-305
Classification Level Classification E-value
Superfamily E set domains 4.43e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000357
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014199   Gene: ENSMMUG00000010834   Transcript: ENSMMUT00000015152
Sequence length 615
Comment pep:known_by_projection chromosome:MMUL_1:13:61054442:61086306:1 gene:ENSMMUG00000010834 transcript:ENSMMUT00000015152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKV
RITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIIS
RIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAP
NTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVA
IVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQ
KLCQDHVETGFCLVDQDGLELLTSGDPPTSASQSAVNFPERPRPGLLGSIGEGRYFKKEP
NLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMTPLPSSSWSSVAHPTPRSGN
TNPLSSFSTGTLPSNSQGIPPFLRIPIGNDLNASNACIYNNADDIVGMEASSMPPADLYG
ISDHNMLSNCSVNMMATSNDSMEETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSM
SAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHSFVQDSQYSGIGSMQ
NEQLSDSFPYEFFQV
Download sequence
Identical sequences 9544.ENSMMUP00000014199 ENSMMUP00000014199 ENSMMUP00000014199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]