SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014368 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014368
Domain Number 1 Region: 75-176
Classification Level Classification E-value
Superfamily SH2 domain 1.21e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 168-214
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000017
Family SOCS box-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014368   Gene: ENSMMUG00000010956   Transcript: ENSMMUT00000015331
Sequence length 215
Comment pep:known_by_projection chromosome:MMUL_1:20:11329779:11330426:-1 gene:ENSMMUG00000010956 transcript:ENSMMUT00000015331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPAAPARPRPCPAVPAPAPAPAPGDTHFR
TFRSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALS
VKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGTPLRQRRVRPLQE
LCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
Download sequence
Identical sequences A0A2K5UBA5 F7GGH3
ENSMMUP00000014368 XP_001104595.1.72884 XP_005591319.1.63531 ENSMMUP00000014368 9544.ENSMMUP00000014368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]