SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014441 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014441
Domain Number 1 Region: 526-603
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 6.54e-28
Family AN1-like Zinc finger 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014441   Gene: ENSMMUG00000011030   Transcript: ENSMMUT00000015417
Sequence length 608
Comment pep:known_by_projection chromosome:MMUL_1:9:45975632:46007244:-1 gene:ENSMMUG00000011030 transcript:ENSMMUT00000015417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYLDSSRVEVWEKTSCNKQVTFLVYREGDQLNFFPAVDRGDGTLTPLSDSSKKIGFHL
HILRRKGEHRMSGGSMYNSDTDEDEETEPSSSGQQIIENSITMNKMKLLKAKMKNMNLSK
KPKKAVKIKPHPPIAPRPSSGSTAPSRHRLLRVLPNIGQSCLPAFGNAYLPEISRNGVSS
LATQLPAERSMSSITGEFLKENNSWETNTLSHSSSNVKLPPQIPHLELGNDQELADSVLH
LGSSLPRQTKHFLGNLPSSNEDTVLPSEECVIEESLLPEVGSLASFADGNADEQSSGLED
ACKVNPELLLTNADKGLKAPEQHLKHAAGVLSGESVETSVLNYRELSPHKNRLLSPLRCS
APMSLHNSLVKPQRQSKCFEFGKLQPSSRSLDVQNITDCSSSRTPRFQGVKVDSPGKRSD
VISKVEARDITEMANKASKEPVDCVNNISFLASLARSTSRDRLQSTRGAGRPQTSGIGLS
TNLQHFQEENLRKSSPQLEHPEVFLSAHGVGMNGNNAATGKSVGECTTHHLPPVKAPLQA
KKKKTNHCFLCGKKTGLASSYECRCGNNFCASHRYAETHGCTYDYKSAGRRYLHEANPVV
NAPKLPKI
Download sequence
Identical sequences ENSMMUP00000014441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]