SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014474 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014474
Domain Number 1 Region: 18-74
Classification Level Classification E-value
Superfamily GLA-domain 3.03e-21
Family GLA-domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014474   Gene: ENSMMUG00000011053   Transcript: ENSMMUT00000015451
Sequence length 216
Comment pep:known chromosome:MMUL_1:X:35188721:35202388:1 gene:ENSMMUG00000011053 transcript:ENSMMUT00000015451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVFLTGEKANSVLKRYPRANGFFEEIRQGNIERECKEEFCTFEEAREAFENNEKTKEFWS
TYTKAQQGESNRGSDWFQFYLTFPLIFGLFIILLVIFLIWRCFLRNKTRRQTVTEGHIPF
PQHLNIITPPPPPDEVFDSSGLSPGFLGYVVGRSDSVSTRLSNCDPPPTYEEATGQVNLQ
RSETEPHLDPPPEYEDIVNSNSASAIPMVPVVTTIK
Download sequence
Identical sequences A0A096MLD4 A0A2K5HYI8 A0A2K5LY61 A0A2K5ZZ13 A0A2K6ANW5 A0A2K6PMR9 F7GMP4 G7Q2H6 H2RCB7
ENSMMUP00000014474 9544.ENSMMUP00000014474 ENSMMUP00000014474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]