SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014506 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014506
Domain Number 1 Region: 226-348
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-32
Family Cadherin 0.0013
Further Details:      
 
Domain Number 2 Region: 441-566
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-28
Family Cadherin 0.0021
Further Details:      
 
Domain Number 3 Region: 123-230
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-22
Family Cadherin 0.0038
Further Details:      
 
Domain Number 4 Region: 341-445
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-21
Family Cadherin 0.0054
Further Details:      
 
Domain Number 5 Region: 556-662
Classification Level Classification E-value
Superfamily Cadherin-like 3.85e-20
Family Cadherin 0.006
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000014506
Domain Number - Region: 25-115
Classification Level Classification E-value
Superfamily Cadherin-like 0.000186
Family Cadherin 0.0073
Further Details:      
 
Domain Number - Region: 700-730
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0732
Family HIT zinc finger 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014506   Gene: ENSMMUG00000011078   Transcript: ENSMMUT00000015488
Sequence length 1148
Comment pep:known chromosome:MMUL_1:X:98982508:99094741:-1 gene:ENSMMUG00000011078 transcript:ENSMMUT00000015488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLLLPVLLLLAVLWTQAAALINLKYSVEEEQRAGTVIANVAKDAREAGFALDSRQASA
FRVVSNSAPHLVDINPSSGLLVTKQKIDRDLLCRQSPKCIISLEVMSSSMEICVIKVEIK
DLNDNAPSFPAAQMELEISEAASPGTRIPLDSAYDPDSGSFGVQTYELTPNELFGLEIKT
RGDGSRFAELVVEKSLDRETQSHYSFRITALDGGDPPRLGTVGLSIKVTDSNDNNPVFSE
STYSVSVPENSPPNTPVIRLNASDPDEGTNGQVVYSFYGYVNDRTRELFQIDPHSGLVTV
TGALDYEEGHVYELDVQAKDLGPNSIPAHCKVTVSVLDTNDNPPVINLLSVNSELVEVSE
SAPPGYVIALVRVSDRDSGLNGRVQCRLLGNVPFRLQEYESFSTILVDGRLDREQHDQYN
LTIQARDGGVPMLQSAKSFTVLITDENDNHPHFSKPYYQVIVQENNTPGAYLLSVSARDP
DLGLNGSVSYQIVPSQVRDMPVFTYVSINPNSGDIYALRSFNHEQTKAFEFKVLAKDGGL
PSLQSNATVRVIILDVNDNTPVITAPPLINGTAEVYIPRNAGIGYLVTIVKAEDYDEGEN
GRVTYDMTEGDRGFFEIDQVNGEVRTTRTFGESSKSSYELIVVAHDHGKTSLSASALVLI
YLSPALDAQESMGSVNLSLIFIIALGSIAGILFVTMIFVAIKCKRDNKEIRTYNCSNCLT
ITCLLGCFIKGQNSKCLHCISVSPISEEQDKKTEEKVSLRGKRIAEYSYGHQKKSSKKKK
ISKNDIRLVPRDVEETDKMNVVSCSSLTSSLNYFDYHQQTLPLGCRRSESTFLNVENQNT
RNTSANHIYHHSFNSQGPQQPDLIINGVPLPETENYSFDSNYVNSRAHLIKSSSTFKDLE
GNSLKDSGHEESDQTDSEHDVQRSLYCDTAVNDVLNTSVTSMGSQMPDHDQNEGFHCREE
CRILGHSDRCWMPRNPMPIRSKSPEHVRNIIALSIEATAADVEAYDDCGPTKRTFATFGK
DVSDHPAEERPTLKGKRTVDVTICSPKVSSVIREAGNGCEAISPVTSPLHLKSPLPTKPS
VSYTIALAPPARDLEQYVSNVNNGPARPSEAEPRGADSEKVMHEVNPILKEGRHKESPGV
KRLKDIVL
Download sequence
Identical sequences A0A2K5V6I5 F6USP1
ENSMMUP00000014506 ENSMMUP00000014506 9544.ENSMMUP00000014506 NP_001252617.1.72884 XP_005594159.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]