SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014681 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014681
Domain Number 1 Region: 32-199
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-26
Family Laminin G-like module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014681   Gene: ENSMMUG00000011200   Transcript: ENSMMUT00000015673
Sequence length 199
Comment pep:novel chromosome:MMUL_1:19:9810716:9815513:-1 gene:ENSMMUG00000011200 transcript:ENSMMUT00000015673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNRQGLGQPRAGLCLLLAALQLLPGRQAAADPVDVLKALGVRGGQAGVPEGPGFCPQRT
PEGDQAFRVGQASTLGIPTRELFPDGHFPENFSLLITLRGQPANQSVLLSLYDERGARQL
GLALGPALGLLGDPFRPLPQQVNLTDGRWHRVAVSIDGETVTLVADCKAQPPVLGHGPRF
ISIAGLTVLGTQDLGEKTF
Download sequence
Identical sequences ENSMMUP00000014681 ENSMMUP00000014681 9544.ENSMMUP00000014681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]