SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014777 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014777
Domain Number 1 Region: 563-620
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 507-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 171-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.89e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.91e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 423-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.2e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 116-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.97e-22
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 227-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-20
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 9 Region: 1-43
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.12e-18
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 10 Region: 386-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000549
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 11 Region: 470-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000986
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014777   Gene: ENSMMUG00000011275   Transcript: ENSMMUT00000015773
Sequence length 639
Comment pep:known_by_projection chromosome:MMUL_1:19:21613145:21628393:1 gene:ENSMMUG00000011275 transcript:ENSMMUT00000015773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGPLTFQDVTIEFSLEEWQCLDTAQQTLYRDVMLENYRNLVFLVSILKEIKYMSLQLHLI
ESVIIHLKTFTKHKIIHTGEIHFSPQILLTIREFILERKPTNVKKHEKIHTGEKPYKQSS
HLTRHKAIHTGEKPYKCEECGKAFNHFSAPRRHKIIHTGKKPYKCEECGKAFSQSSTLRK
HVIIHTGEKPYKCEECGKAFKWSSKLTLHKVIHTGEKPCKCEECGKAFKHFPALRKHKVI
HTREKLYKCEECGKAFNNFSTVMKHKIIHTGEKPYKCEECGKAFKWSSKLTLHKVIHTGE
KPCKCEECGKAFKHFSALRKHKIIHTGKKPYKCEECGKAFNNSSTLMKHKIIHTGKKPYK
CEQCGKAFKQSSHLTRHKVIHTGEKPYKCEECGKDFNNPSTLKKHKLIHTREKLYKCEEC
GKAFNNFSALLKHKIIHTGEKPYKCEECGKAFKWSSKLTEHKVIHTGEKPCKCEECGKAF
KHFSALRKHKIIHTGKKPYKCEECGKAFNNSSTLMKHKIIHTGEKPYKCEECGKAFNNFS
TLMKHKIIHTGEKPYKCEECGKAFNNSSTLMKHKIIHTGEKPYKCEECGKAFNNFSTLRK
HKRIHTGKKPYKCDECGKAFNNFSTLTKHNSFCRETLQM
Download sequence
Identical sequences ENSMMUP00000014777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]