SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014824 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014824
Domain Number 1 Region: 15-218
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.48e-56
Family Proteasome subunits 0.00000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014824   Gene: ENSMMUG00000011304   Transcript: ENSMMUT00000015822
Sequence length 219
Comment pep:known chromosome:MMUL_1:4:32549849:32555277:1 gene:ENSMMUG00000011304 transcript:ENSMMUT00000015822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVVGSDSRVSAGEAVVNRVFDKLSPLHQR
IYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNITYKYREDLSAHLMV
AGWDQHEGGQVYGTLGGMLTRQPFAIGGSGSTYIYGYVDAAYKPGMSPEECRRFTTDAIA
LAMSRDGSSGGVVYLVTITAAGVDHRVILGNELPKFYDE
Download sequence
Identical sequences A0A2K6D3R8 A5HLX2 F6UNF6
ENSMMUP00000014824 9544.ENSMMUP00000014824 NP_001270096.1.63531 XP_001108087.2.72884 XP_011727334.1.29376 ENSMMUP00000014824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]