SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014910 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014910
Domain Number 1 Region: 898-1010
Classification Level Classification E-value
Superfamily SEA domain 6.54e-18
Family SEA domain 0.0086
Further Details:      
 
Domain Number 2 Region: 244-337
Classification Level Classification E-value
Superfamily SEA domain 0.000000000275
Family SEA domain 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000014910
Domain Number - Region: 1058-1100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0275
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014910   Gene: ENSMMUG00000011362   Transcript: ENSMMUT00000015910
Sequence length 1242
Comment pep:known_by_projection chromosome:MMUL_1:2:21410074:21508060:-1 gene:ENSMMUG00000011362 transcript:ENSMMUT00000015910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMFPLFGKISLGILIFVLIGDFPSLTAQTYLSLEEIQEPKSAVSFLLPEESTDLSLATK
KKQPLDLRETERQWLLRRRRSILFPNGVKICPDESVTEAVANHVKYFKVRVCQEAVWEAF
RTFWDRLPGREEYHYWMNLCEDGVTSIFEMGTNFSESVEHRSLIMKKLTYAKETVSSPEL
SSPVPVGDTSTLGDTALSVPHPGVDSYEGASDSSLERPEESISNEIENVIEEATKPAAEQ
IAEFSIHLLGKEYREELQDSSSFHHQHLEEEFISEVENAFTGLPGYKEIRVLEFRSPKEN
DSGVDVYYAVTFNGEAISNTTWDLISLHSNKVENHGLVELDDKPTVVYTISNFRDYIAET
LQQNFLLGNSSLNPDPDSLQLINVRGVLRHQTEDLVWNTQSSSLQATPSSILDNTFQAAW
PSADESTTSSIPPLDFSSGPPSATGRELWSESPLGDLVSTHKLAFPSKMGLSSSPEVLEV
SSLTLHSVTPAVLQTGLPVASEERTSGSHLVEDGLANVEESEDFPSIDSLPSSSFTQPVP
KETIPSMEDSDVSLTSSPYLTSSIPFGLDSLTSKVKDQLKVSPFLPDASMEKELILDSGL
GSGSGQKVDLITWPWSETSSEKSTEPLSKPWLEDDDSLLPAEIEDEKLVLVDKMDSTDQI
SKHSKYEHDDRSTHFPEEEPLSGPAVPIFADTATESASLTLPKHISEVPGVDDYSVTKAP
LILTSVAISASTEISDQADAILREDTEQTTESSNYEWFDSEVSMVKPDMQPLWTILPESE
RVSTRTSSLEKLSRDTLASTPQSTDRLWLKASVTQSTKLPPTTISTLLEDEVIMGVQDIS
LELDRIGTDYYQPELVQEQNGKVGSYVEMSTSVHSTEMVSVAWPTEGGDDLSYTQTSGAL
VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNLEILNFRNGSI
VVNSRMKFANSVPPNVNTAVYMILEDFCTAAYNTMNLAIDKYSLDVESGDEANPCKFQAC
NEFSECLVNPWSGEAKCRCFPGYLSVEERPCQSLCDLQPDFCLNDGKCDIMPGHGAICRC
RVGENWWYRGKHCEEFVSEPVIIGITIASVVGLLVIFSAIIYFFIRTLQAHHDRSERERP
FSGFSRQPDSLSSIENAVKYNPVYKSHRTGCEKYEGPYPQHPFYSSASGDMIGGLSREEI
RQMYESSELSREEIQERMRVLELYANDPEFAAFVKEQQVEEV
Download sequence
Identical sequences ENSMMUP00000014910 9544.ENSMMUP00000014910 ENSMMUP00000014910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]