SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014969 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014969
Domain Number 1 Region: 250-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000111
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 2 Region: 434-480
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000893
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 3 Region: 377-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 4 Region: 307-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000698
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 5 Region: 59-136
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000187
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014969   Gene: ENSMMUG00000011408   Transcript: ENSMMUT00000015974
Sequence length 664
Comment pep:novel chromosome:MMUL_1:18:7229916:7268697:1 gene:ENSMMUG00000011408 transcript:ENSMMUT00000015974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLFPAILNLASNADISTNATCGEKGPEMFCKLVEHVPGRPVRNPQCRICDGNSVNPRERH
PISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVAYVIIKAANAPRPGNWILERS
LDGTTFSPWQYYAVSDSECLSRYNITPRRGPPTYRADDEVICTSYYSRLVPLEHGEIHTS
LINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMTLSHREPKDLDPIVTRRYYYS
IKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNTCGESCNRCCPGYHQRPWRPGTVSS
GNTCEACNCHNKAKDCYYDESVAKQKKSLNTAGQFRGGGVCTNCLQNTMGINCETCIDGY
YRPHKVSPYEDEPCRPCDCDPVGSLSSVCVKDDLHSDLRNGKGPGQCPCKEGYAGEKCDR
CQLGYKDYPACVSCGCNPVGSASDEPCTGPCVCKENVEGKACDRCKPGFYNLKEKNPQGC
SECFCFGVSDVCSSLSWPVGQVSNMSGWLVTDLISPRRIPSQQDALGGRHQVSINNTAVM
QRLAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETVDSNLMSHADVIIKGNRLTLS
TQAEGLSLQPYEEYLNVVRLVPENFRDFHSKRQIDRDQLMTVLANVTHLLIRANYNSAKM
ALYR
Download sequence
Identical sequences F6VZ75
9544.ENSMMUP00000014969 ENSMMUP00000014969 ENSMMUP00000014969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]