SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014974 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014974
Domain Number 1 Region: 291-368
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.67e-28
Family Nuclear receptor 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014974   Gene: ENSMMUG00000011410   Transcript: ENSMMUT00000015979
Sequence length 442
Comment pep:known chromosome:MMUL_1:15:36391520:36397371:-1 gene:ENSMMUG00000011410 transcript:ENSMMUT00000015979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYSPSPPGSSYAAQTYSSEYATEIMNPDYTKLTMDLGSTEITATATTSLPSIST
FVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQQQHQQPSIPPA
SSPEDEVLPSTSMYFKQSPPSTPTTPAFPPQAGALWDDALPSAPGCIAPGSLLDPPMKAV
PTVAGARFPLFHFKPSPPHPPAPNPAGGHHLGYDPTAAAALSLPLGAAAAAGSQVAALEG
HPYGLPLAKRAAPLAFPPLGLTPSPTASSLLGESPSLPSPPNRSSSSGEGTCAVCGDNAA
CQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLSVGMVKE
VVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPVCMMNALVRALTDSTPRDLDYSRVS
FMISFFQMNDQGYLWLLVIRVD
Download sequence
Identical sequences ENSMMUP00000014974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]