SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014992 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014992
Domain Number 1 Region: 55-172
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.66e-28
Family Glutathione peroxidase-like 0.00049
Further Details:      
 
Domain Number 2 Region: 187-313
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000299
Family PDI-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014992   Gene: ENSMMUG00000011425   Transcript: ENSMMUT00000015997
Sequence length 315
Comment pep:known chromosome:MMUL_1:16:589700:612858:-1 gene:ENSMMUG00000011425 transcript:ENSMMUT00000015997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKLWNKYRISNIPSLIFLDATTGKVVCRNGLLVIRDDPEGLEFPWGPKPFREVIAGPLLR
NNGQSLESSSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQSFEIIFVSADRSE
ESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIVLDPQGEVITRQGRVEVLNDE
DCREFPWHPKPVLELSDSNATQLNEGPCLVLFVDSEDDGESEAAKQLIQPIAEKIIAKYK
AKEEEAPLLFFVAGEDDMTDSLRDYTNLPEAAPLLTILDMSARAKYVMDVEEITPAIVEA
FVNDFLAEKLKPEPI
Download sequence
Identical sequences ENSMMUP00000014992 ENSMMUP00000014992 9544.ENSMMUP00000014992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]