SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014996 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014996
Domain Number 1 Region: 22-151
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000207
Family FAD/NAD-linked reductases, N-terminal and central domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014996   Gene: ENSMMUG00000011429   Transcript: ENSMMUT00000016002
Sequence length 200
Comment pep:known_by_projection chromosome:MMUL_1:10:53532939:53567875:1 gene:ENSMMUG00000011429 transcript:ENSMMUT00000016002 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISYALNHTNRKLTLEPKITVNAKIIVVGASNVGISFLETLVFCSHLKFNNLTLISTHGLP
GKKLLDTEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTGIDRAAKHVVLSTGEIVLY
DHLILCTGQQYQVPCPTGADISQHLTNREVPNSSQRRYTGKVPCNHFTLNEEEDCFKALT
WIRNNSITTEDGGIASVLFC
Download sequence
Identical sequences A0A2K5TNP8 A0A2K6CTS8 F6VR60
ENSMMUP00000014996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]