SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015021 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000015021
Domain Number - Region: 546-587
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0575
Family Fibrinogen C-terminal domain-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015021   Gene: ENSMMUG00000011444   Transcript: ENSMMUT00000016028
Sequence length 753
Comment pep:known chromosome:MMUL_1:11:45046010:45061237:-1 gene:ENSMMUG00000011444 transcript:ENSMMUT00000016028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVAGLPGIGIPALHPGELGRGLGSLPVGSLVLFCGGWATAGTSLLNWGQRGLTGPIGPP
GPAGANGEKGEVGPPGPAGSAGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGEQGEA
GQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRVGPPGSNGNP
GPPGPPGPSGKDGPKGARGDSGPPGRAGDPGLQGPAGPPGEKGEPGDDGPSGADGPPGPQ
GLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPGPVGPPGLTGPAGEP
GREGSPGADGPPGRDGAAGVKGDRGETGAVGAPGSPGPPGSPGPAGPTGKQGDRGEAGAQ
GPMGPSGPAGARGIQGPQGPRGDKGEAGEPGERGLKGHRGFTGLQGLPGPPGPSGDQGAS
GPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPGPRGRSGETGPAGPPGNPGPPGPPGPP
GPGIDMSAFAGLGPREKGPDPLQYMRADQAAGGLRQHDAEVDATLKSLNNQIESIRSPEG
SRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETGETCVYPNPANVPKK
NWWSSKSKEKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRLLSTEGSQNITYHCK
NSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTALKDDCTKHTGKWGKTVIEYRS
QKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCFL
Download sequence
Identical sequences ENSMMUP00000015021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]