SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015112 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015112
Domain Number 1 Region: 1381-1539
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-41
Family C-type lectin domain 0.00000564
Further Details:      
 
Domain Number 2 Region: 144-259
Classification Level Classification E-value
Superfamily C-type lectin-like 7.06e-41
Family Link domain 0.0025
Further Details:      
 
Domain Number 3 Region: 252-353
Classification Level Classification E-value
Superfamily C-type lectin-like 1.97e-30
Family Link domain 0.0029
Further Details:      
 
Domain Number 4 Region: 29-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000167
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 
Domain Number 5 Region: 1540-1598
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000556
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 1336-1377
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000607
Family EGF-type module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015112   Gene: ENSMMUG00000011513   Transcript: ENSMMUT00000016125
Sequence length 1642
Comment pep:known chromosome:MMUL_1:6:79659710:79768330:1 gene:ENSMMUG00000011513 transcript:ENSMMUT00000016125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLININSILWMCSTLIATHALHKVKVGKSPPLRGSLSGKVSLPCHFSTMPTLPPSYNTSE
FLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKL
LASDAGLYRCDVMYGIDDTQDTVSLAVDGVVFHYRASTSRYTLNFEAAQKACLDIGAVIA
TPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDMMGKAGVRTYGFRSPQETYD
VYCYVDHLDGDVFHLTAPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLS
DASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKEATTIDLSILA
ETASPSLSKEPQMVSDRTTPIIPLVDELPVIPTEFPPVGNIVDFEQKATVQPQAVTDSLA
TKLPTPTGSSKKPWDMDDYSPSASGPLGKPDISEFKDEVLQSTTVVSHYATDSWDGVVED
TQTQESVTQIEQIEVGPLVTSMEILKHIPSKEFPVTETPLVTGRMTLESKTEKKTVSTVS
ELVTTGHYGFTLGEEDDEDRTLPVGSDESTLIFDQTPEVVTVSKTSEDTTDTQLEDLETV
LASTTVLPLIMPDNNGSSMDDWEQRETNGRITEDFFGKYLSTTPFPSQHHTEIELFPYSG
DKILVEGISTVIYPSPQTEMTHRRERTETLIPEMRTDTYTDEIQEEITKSPFMGKTEEED
FSGMKLSTSPSEPIHVTESSVEMTKSFDFPTLTTKLSAEPTEVRDMEEEFTATPGTIKYD
ENTTTVHLTHSTLSVEAATISKWSWDEDNITSKPLESTEPSASSKLPPALLTTVGMNGKD
KEIPSFTEDGADEFTLIPDSTQKQLEEITDEDIAVHGKFTIRFQPTTSIGIAEKSTLRDS
ITEEKVPPITSTEGRVYATMEGSTLGEVEDVDLSKSVSTVPQLAHTSEAEGLAFVSYSST
QEPTTYVDSSHTIPLSVIPKTDWGVLVPSVPSEDEVLGEPSQDIRVIDQTHLEVTISPET
IRTTKLTEETTQEEFPWKEQTAEKPVPALSSTAWTPKEAVTPLDEQEGDGSAYTVSEDEL
LTGSESISVLETTPVGKIDHSVSYPPGAITEHKVKTVEVVTLTPSIGPKVSISPGPEQKY
ETEGSSTTGFTSSLSPFSTHVTQLMEETTAEKISLEDIDLGSGLFEKPKATELIEFSTIK
ATVPSDITTAFSSVDRLHTTSALKPASAITKKPPLIDREPGEETTSDMVIIGESTSHVPP
TTLEDIVAKETETDIDREYFTTSSPPTTQPTRPPTVEDKEAFGPQALSTPQPPARTKFHP
DINVYIIEVRENKTGPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSN
PCRNGATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAE
RECRLQGAHLTSILSHEEQTFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQ
PDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPR
YEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQRTYSMKYFKNSSSAK
DNSINTSKHDHRWSRRWQETRR
Download sequence
Identical sequences ENSMMUP00000015112 XP_014995845.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]