SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015114 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015114
Domain Number 1 Region: 144-259
Classification Level Classification E-value
Superfamily C-type lectin-like 6.92e-43
Family Link domain 0.0025
Further Details:      
 
Domain Number 2 Region: 393-552
Classification Level Classification E-value
Superfamily C-type lectin-like 2.8e-42
Family C-type lectin domain 0.00000528
Further Details:      
 
Domain Number 3 Region: 252-351
Classification Level Classification E-value
Superfamily C-type lectin-like 1.45e-30
Family Link domain 0.0035
Further Details:      
 
Domain Number 4 Region: 29-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000432
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 
Domain Number 5 Region: 349-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000113
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 6 Region: 553-611
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000181
Family Complement control module/SCR domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015114   Gene: ENSMMUG00000011513   Transcript: ENSMMUT00000016127
Sequence length 655
Comment pep:known chromosome:MMUL_1:6:79671381:79769119:1 gene:ENSMMUG00000011513 transcript:ENSMMUT00000016127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLININSILWMCSTLIATHALHKVKVGKSPPLRGSLSGKVSLPCHFSTMPTLPPSYNTSE
FLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQDYKGRVSVPTHPEAVGDASLTVVKL
LASDAGLYRCDVMYGIDDTQDTVSLAVDGVVFHYRASTSRYTLNFEAAQKACLDIGAVIA
TPEQLFAAYEDGFEQCDAGWLADQTVRYPIRAPRVGCYGDMMGKAGVRTYGFRSPQETYD
VYCYVDHLDGDVFHLTAPSKFTFEEAAKECENQDARLATVGELQAAWRNGFDQCDYGWLS
DASVRHPVTVARAQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKRPDRCKMNPCLNG
GTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRNGATCVDGFNTFRCLCLPSYVGAL
CEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERECRLQGAHLTSILSHEEQTFVNRVGH
DYQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPC
NYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIRCLG
NGRWAIPKITCMNPSAYQRTYSMKYFKNSSSAKDNSINTSKHDHRWSRRWQETRR
Download sequence
Identical sequences A0A2K5V3X1 A0A2K6CTN8 F7C5R1
ENSMMUP00000015114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]