SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015143 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015143
Domain Number 1 Region: 2-157
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.88e-24
Family Canonical RBD 0.00025
Further Details:      
 
Domain Number 2 Region: 396-479
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.96e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 3 Region: 276-355
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.14e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 4 Region: 192-268
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000124
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 5 Region: 484-562
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000133
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015143   Gene: ENSMMUG00000011533   Transcript: ENSMMUT00000016156
Sequence length 577
Comment pep:known_by_projection chromosome:MMUL_1:16:33231513:33285846:1 gene:ENSMMUG00000011533 transcript:ENSMMUT00000016156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGK
VELQGKRLEIEHSVPKKQRSRKIQIRSIPPQFRWEVLDSLLAQYGTVENCEQVNTESETA
VVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQG
SPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAA
EKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLK
KVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSL
QSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAI
IGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENFF
GPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKII
GHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK
Download sequence
Identical sequences ENSMMUP00000015143 9544.ENSMMUP00000015143 ENSMMUP00000015143 NP_001180850.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]