SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015154 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015154
Domain Number 1 Region: 30-141
Classification Level Classification E-value
Superfamily PH domain-like 8.5e-40
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000000765
Further Details:      
 
Domain Number 2 Region: 207-303
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 2.75e-33
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000627
Further Details:      
 
Domain Number 3 Region: 382-493
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 3.79e-25
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015154   Gene: ENSMMUG00000011544   Transcript: ENSMMUT00000016169
Sequence length 505
Comment pep:known chromosome:MMUL_1:3:161220919:161283219:-1 gene:ENSMMUG00000011544 transcript:ENSMMUT00000016169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVQQQPPPPRRVTNVGSLLLTPQENESLFTFLGKKCVTMSSAVVQLYAADRNCMWSKK
CSGVACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALN
FANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVN
NISHTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCG
ISEAQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHNSGPP
PPPARGRGAPPPPPSRAPTAAPPPPPPSRPSVAVPPPPPNRMYPPPPPALPSSAPSGPPP
PPPSVLGVGPVAPPPPPPPPPPPGPPPPTGLPSDGDHQVPTTAGNKAALLDQIREGAQLK
KVEQNSRPVSCSGRDALLDQIRQGIQLKSVSDGPESTPPTPAPTSGIVGALMEVMQKRSK
AIHSSDEDEDEDDEEDFEDDDEWED
Download sequence
Identical sequences A0A1D5RB13 A0A2K5VG25 A0A2K6CKE4
9544.ENSMMUP00000015154 ENSMMUP00000015154 NP_001253726.1.72884 XP_005550703.1.63531 XP_011728266.1.29376 ENSMMUP00000015154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]