SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015276 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015276
Domain Number 1 Region: 298-494
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.47e-48
Family Reprolysin-like 0.00023
Further Details:      
 
Domain Number 2 Region: 511-585
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.00000971
Family Blood coagulation inhibitor (disintegrin) 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000015276
Domain Number - Region: 741-769
Classification Level Classification E-value
Superfamily EGF/Laminin 0.046
Family Integrin beta EGF-like domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015276   Gene: ENSMMUG00000011641   Transcript: ENSMMUT00000016305
Sequence length 831
Comment pep:known_by_projection chromosome:MMUL_1:12:70338667:70507378:1 gene:ENSMMUG00000011641 transcript:ENSMMUT00000016305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPGRSSRRPPLAGCSLAGASCGPKRGPAGLVPACAPARTPPCRLLLVLLLLPPLAASY
RPRAWGAAAPSAPRWNETAEKNLGVLAEEDNTLQQNSSSNISYSNAMQKEITLPSRLIYY
INQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILDLILNNGLLSSDYVEI
HYENGKPQYSKGGEHCYYHGSIRGVKDSKVALSTCNGLHGMFEDDTFVYMIEPLELVHDE
KSTGRPHIIQKTLAGQYSKQMKNLTMERGDQWPFLSELQWLKRRKRAVNPSRGIFEEMKY
LELMIVNDHKTYKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTERDQID
ITTNPVQMLHEFSKYRQRIRQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYG
LPMAVAQVLSQSLAQNLGIQWEPSSRKPKCDCTESWGGCIMEETGVSHSRKFSKCSVLEY
RDFLQRGGGACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGLCCKKCSLSNGAHC
SDGPCCNNTSCLVSPDISVCTLSIFACVFLNVSNNILQCPPNLHKQDGYACNQNQGRCYN
GECKTRDNQCQYIWGTKAAGSDKFCYEKLNTEGTEKGNCGKDGDRWIQCSKHDVFCGFLL
CTNLTRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMCL
DRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNLHPPK
DEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI
Download sequence
Identical sequences 9544.ENSMMUP00000015276 ENSMMUP00000015276 ENSMMUP00000015276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]