SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015343 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015343
Domain Number 1 Region: 231-368
Classification Level Classification E-value
Superfamily Cadherin-like 9.68e-29
Family Cadherin 0.00036
Further Details:      
 
Domain Number 2 Region: 460-589
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-23
Family Cadherin 0.0022
Further Details:      
 
Domain Number 3 Region: 348-464
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-18
Family Cadherin 0.0002
Further Details:      
 
Domain Number 4 Region: 32-155
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000361
Family Cadherin 0.002
Further Details:      
 
Domain Number 5 Region: 142-243
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000628
Family Cadherin 0.0019
Further Details:      
 
Domain Number 6 Region: 571-671
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000538
Family Cadherin 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015343   Gene: ENSMMUG00000011687   Transcript: ENSMMUT00000016374
Sequence length 901
Comment pep:known_by_projection chromosome:MMUL_1:18:24012204:24047230:-1 gene:ENSMMUG00000011687 transcript:ENSMMUT00000016374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARPSGSWSGALCRLLLLTLAILIFASDACKNVTLYVPSKLDAEKLIGRVNLKECFTA
ANLIHSSDPDFQILEDGSVYTTNSILLSSEKRSFTILLSNTENQEKKKIFVFLEHQTKVL
KKRQTKETVLRRAKRRWAPIPCSMLENSLGPFPLFLQQVQSDTAQNYTIYYSIRGPGVDQ
EPRNLFYVERDTGNLYCTRAVDREQYESFEIIAFATTPDGYTPELPLPLIIKIEDENDNY
PIFTEETYTFTIFENCRVGTTVGQVCATDKDEPDTMHTRLKYSIIGQVPPSPTLFSMHPT
TGVITTTSSQLDRELIDKYQLKIKVQDMDGQYFGLQTTSTCIINIDDVNDHLPTFTRTSY
VASVEENTVDVEILRVTVEDKDLVNTANWRANYTILKGNENGNFKIVTDAKTNEGILCVV
KPLNYEEKQQVILQIGVVNEAPFSREASSRSAMSTATVTVNVRDQDEGPECNPPIQTVRM
SENAAVGTTSNGYKAYDPETRSSSGIRYKKLTDPTGWVTIDENTGSIRVFRSLDREAETI
RNGIYNITVLASDQAGRTCTGTLGIILQDVNDNGPFIPKKTVIICKPTMSSAEIVAVDPD
EPINGPPFDFSLESSTSDVQRMWRLNKINDTAARLSYQNDPAFGSYVVPITVRDRLGMSS
VTSLDVVLCDCITENDCTHRADPRIGGGGVQLGKWAILAILLGIALLFCILFTLVCGASG
ISKQPKVIPDDLAQQNLIVSNTEAPGDDKVYSANGFTTQTVGASAQGVCGTMGSGVKNGG
QETIEMVKGGHQTLESCRGAGHHHTLDSCKGGHTEVDNCRYTYSEWHSFTQPRLGEKVYL
CNQDENHKHAQDYVLTYNYEGRGSVAGSVGCCSERQEEDGLEFLDNLEPKFRTLAEACMK
R
Download sequence
Identical sequences F7HEK0
XP_001102096.2.72884 9544.ENSMMUP00000015343 ENSMMUP00000015343 ENSMMUP00000015343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]