SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015348 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015348
Domain Number 1 Region: 230-366
Classification Level Classification E-value
Superfamily Cadherin-like 2e-30
Family Cadherin 0.00018
Further Details:      
 
Domain Number 2 Region: 465-583
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-19
Family Cadherin 0.0012
Further Details:      
 
Domain Number 3 Region: 348-464
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-16
Family Cadherin 0.00032
Further Details:      
 
Domain Number 4 Region: 140-242
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000857
Family Cadherin 0.00072
Further Details:      
 
Domain Number 5 Region: 31-154
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000377
Family Cadherin 0.0024
Further Details:      
 
Domain Number 6 Region: 580-667
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000186
Family Cadherin 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015348   Gene: ENSMMUG00000011690   Transcript: ENSMMUT00000016379
Sequence length 894
Comment pep:known_by_projection chromosome:MMUL_1:18:24060489:24089730:-1 gene:ENSMMUG00000011690 transcript:ENSMMUT00000016379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVASAAPGSIFCKQLLFSLLVLILLCDACQKIYLRVPSHLQAETLVGKVNLEECLKSPS
LIQSSDPAFRILEDGSIYTTRDLILSSERKSFSIFLSGSERHEQQEIKVVLSARENKAPK
KRHTKDTALKRSKRRWAPIPASLMENSLGPFPQHVQQIQSDAAQNYTIFYSISGPGVDKE
PFNLFYIEKDTGDIFCTRSIDREKYEQFALYGYATTADGYAPEYPLPLIIKIEDDNDNAP
YFEHKMTIFTVPENCRSGTSVGQVTATDLDEPDTLHTRLKYKILQQIPDHPKHFSIHPDT
GVITTTTPFLDREKCDTYQLIMEVRDMGGQPFGLFNTGTITISLEDENDNPPSFTESFYI
TEVEENRIDVEILRMKVQDQDLPNTPHSKAVYTILQGNENGNFKISTDPNTNEGVLCVVK
PLNYEVNRQVILKVGVVNEAQFSKAANSQTPTMCTTTVTVKIIDNDEGPECHPPVKVIQS
QDGFPAGQELLGYKALDPETASGEGLRYQKLGDEDHWFEINEHTGDLRTLKVLDRESKFV
KNNQYNISVVAVDAVGRSCTGTLVVHLDDYNDHPPQIDKEVTICQNNKDFAVLEPVDPDG
PENGPPFQFFLNNSASKNWNLEQKDGKTAILRQRQNLDYNSYSVPIQIKDRHGLVATHVL
TVRVCDCSTPSECRMNDKSARDVRPNVILGRWAILAMVLGSVLLLCILFTCFCVTAKRTV
KKCFPEDIAQQNLIVSNTEGPGEEVTEANIRLPMQTSNICDTSMSVGTVGGQGIKTQQSF
EMVKGGYTLDSSKGGGHQTLESVKGVGQGDTGRYAYTDWQSFTQPRLAKKVYLCGQDEEH
KHCEDYVRSYNYEGKGSLAGSVGCCSDRQEEEGLEFLDQLEPKFRTLAKTCVKK
Download sequence
Identical sequences ENSMMUP00000015348 9544.ENSMMUP00000015348 ENSMMUP00000015348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]