SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015389 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015389
Domain Number 1 Region: 39-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.19e-21
Family Extended AAA-ATPase domain 0.00000551
Further Details:      
 
Domain Number 2 Region: 254-341
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 0.00000000468
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015389   Gene: ENSMMUG00000011729   Transcript: ENSMMUT00000016426
Sequence length 349
Comment pep:novel chromosome:MMUL_1:12:72038181:72040929:-1 gene:ENSMMUG00000011729 transcript:ENSMMUT00000016426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVQVSSGVAGKHEAQEPASAPSKALAGPTTASCMARAQVIRYRPVKLNEIVRNEYTVGR
LQIFAREGNMPHIIFAGPLGTDKVISILGPALKDAMLELSANGKGIDVARNKIEMFARQK
VILPKGQHKIVILDEADSITDGVQQTLRGTVEICSKMTHCVLAFNASDKITEATGSQCTV
LRYTKLTDAQTYAKLINAREKGTVLSTDFGLEAIIFMAQGDMRQSLNNLQSIFPGSGFSY
SKNLLRVCDESHPLMKEVIQHCVNADVKETYNSSPKSASPVHLWHLGYSPDVIGNIFQVC
KSFQMAEDKVEFVKEIGYTGMKAAGVNSLLQTTGLLARLCQKTMALVAS
Download sequence
Identical sequences ENSMMUP00000015389 ENSMMUP00000015389 9544.ENSMMUP00000015389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]