SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015481 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015481
Domain Number 1 Region: 42-139
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.63e-37
Family Cold shock DNA-binding domain-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015481   Gene: ENSMMUG00000011793   Transcript: ENSMMUT00000016525
Sequence length 139
Comment pep:known_by_projection chromosome:MMUL_1:19:45275553:45277549:1 gene:ENSMMUG00000011793 transcript:ENSMMUT00000016525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWSGLLRGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKG
VVLSTFTLKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHNLQEHHVVLVEGGRTQDLPG
VKLTVVRGKYDCGHVQKKK
Download sequence
Identical sequences G7PXI2
ENSMMUP00000015481 9544.ENSMMUP00000031621 ENSMMUP00000015481 ENSMMUP00000031621 XP_001086153.1.72884 XP_001086380.1.72884 XP_005589207.1.63531 XP_005589208.1.63531 XP_005589209.1.63531 XP_014979368.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]