SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015494 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015494
Domain Number 1 Region: 193-313
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-32
Family Cadherin 0.00092
Further Details:      
 
Domain Number 2 Region: 630-733
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-30
Family Cadherin 0.0017
Further Details:      
 
Domain Number 3 Region: 525-636
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-28
Family Cadherin 0.00046
Further Details:      
 
Domain Number 4 Region: 414-522
Classification Level Classification E-value
Superfamily Cadherin-like 4.83e-27
Family Cadherin 0.0013
Further Details:      
 
Domain Number 5 Region: 301-418
Classification Level Classification E-value
Superfamily Cadherin-like 5.07e-20
Family Cadherin 0.011
Further Details:      
 
Domain Number 6 Region: 84-205
Classification Level Classification E-value
Superfamily Cadherin-like 7.72e-20
Family Cadherin 0.0037
Further Details:      
 
Domain Number 7 Region: 24-90
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000772
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015494   Gene: ENSMMUG00000011807   Transcript: ENSMMUT00000016542
Sequence length 733
Comment pep:known chromosome:MMUL_1:5:117648503:117652603:1 gene:ENSMMUG00000011807 transcript:ENSMMUT00000016542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQVFQVLEEQPPGTLVGTIQTRPGFTYRLSESHALFAINSSTGALYTTSTIDRESLPSDV
INLVVLSSAPTYPTEVRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIG
SNGVDHRSYRIIRGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDK
GEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADI
RYRLQDEGTPFQMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLD
VNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSSAANGNISVQILGGNEQR
HFEQNPKNLFAINGKNGTISLLGPLDVQAGSYQIEILASDMGVPQLSSSVILTVYVHDVN
DNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGIFPDG
QLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVTVILEDDINDNAPKFLKDFYQATI
SESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAIDITSGQVALIGKLDYEATP
AYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTA
TDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPP
RSSTMSVVIHVRD
Download sequence
Identical sequences ENSMMUP00000015494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]