SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015552 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015552
Domain Number 1 Region: 196-334
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-33
Family Cadherin 0.00000767
Further Details:      
 
Domain Number 2 Region: 315-426
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-21
Family Cadherin 0.0000472
Further Details:      
 
Domain Number 3 Region: 1-119
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-17
Family Cadherin 0.0021
Further Details:      
 
Domain Number 4 Region: 421-519
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-16
Family Cadherin 0.00036
Further Details:      
 
Domain Number 5 Region: 105-200
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000007
Family Cadherin 0.00000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015552   Gene: ENSMMUG00000011850   Transcript: ENSMMUT00000016602
Sequence length 828
Comment pep:known_by_projection chromosome:MMUL_1:20:67161770:67194574:1 gene:ENSMMUG00000011850 transcript:ENSMMUT00000016602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSFEDCTGRQRTAYFSLDTRFKVGPDGVITVKRPLQFHNPQIHFLVYAWDSTYRKFSTKV
TLNTVGHHSRTPPLHASVSGVQAELLTFPNSSPGLRRWKRDWVIPPISCPENEKGPFPKN
LVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRENIATYTLFSHA
VSSNGNAVEDPMEILITVTDQNDNKPVFTQEVFKGSVMEGALPGTSVMEVTATDADDDVN
TYNAAIAYSILSQDPELPDKNMFTINKNTGVISVVTTGLDRESFPMYTLVVQAADLQGEG
LSTTATAVITVTDTNDNPPVFNPTTYKGQVPENQANFVITTLKVTDADAPNTPAWEAVYT
ILNDNDGQFVVTTNPVTNDGILKTAKGLDFEAKQQYILHVAVTNVAPFEVSLTTSTATVT
VDVLDVNEAPIFVPPEKRVEVSEDFGVGQEITSYTAREPDTFMEQKITYRIWRDAANWLE
INPDTGAISTRAELDREDVEHVKNSTYTALIIATDNGKPLCLLCGSFQTLSVYLNTLLPI
PSENNFLKFTVMPSRHIYLSIVPWVPIFPTTICLVLCQDVKETQTEVWLSPAQESIILKP
KIALEVGDYKINLKLMDNQKKDQVTTLEVSVCDCEGAAGICKKAPLVEAGMQIPAILGIL
GGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHR
GLDARPEVTRNDVAPTLLSVPRYLPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFD
YEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGEDD
Download sequence
Identical sequences 9544.ENSMMUP00000015552 ENSMMUP00000015552 ENSMMUP00000015550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]