SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015564 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015564
Domain Number 1 Region: 2-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.48e-23
Family Thioltransferase 0.0000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015564   Gene: ENSMMUG00000010322   Transcript: ENSMMUT00000016615
Sequence length 85
Comment pep:known chromosome:MMUL_1:15:25948755:25961856:1 gene:ENSMMUG00000010322 transcript:ENSMMUT00000016615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKQIESKAAFQEALNTAGDKLVVVDFSATWCGPCKMIKPFFHDVASECEVKCMPTFQFF
KKGQKVGEFSGANKEKLEATINELV
Download sequence
Identical sequences A0A2I3MRJ9 A0A2K5M676 A0A2K5TU69 A0A2K6E695 A0A2K6MZE8 A0A2K6QBW5 F7H4M5
ENSMMUP00000015564 XP_011936874.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]