SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015598 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015598
Domain Number 1 Region: 971-1098,1130-1336
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.37e-78
Family p120GAP domain-like 0.00018
Further Details:      
 
Domain Number 2 Region: 36-200
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-39
Family Calponin-homology domain, CH-domain 0.0000161
Further Details:      
 
Domain Number 3 Region: 1561-1658
Classification Level Classification E-value
Superfamily RGC domain-like 7.45e-33
Family RGC domain 0.00000176
Further Details:      
 
Domain Number 4 Region: 633-836
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000743
Family Nucleotide and nucleoside kinases 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015598   Gene: ENSMMUG00000011882   Transcript: ENSMMUT00000016652
Sequence length 1658
Comment pep:known_by_projection chromosome:MMUL_1:7:70098250:70212368:1 gene:ENSMMUG00000011882 transcript:ENSMMUT00000016652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAADEVDGLGVARPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGE
DLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQTRYKATGLHFRHTDNVIQWL
NAMDEIGLPKIFYPETTDIYDRKNMPRCIYCIHALSLYLFKLGLAPQIQDLYGKVDFTEE
EINNMKTELEKYGIQMPAFSKIGGILANELSVDEAALHAAVIAINEAIDHRIPADTFAAL
KNPNAMLVNLEEPLASTYQDVLYQAKQDKMTNAKNRTENSERERDVYEELLTQAEIQGNV
NKVNTFSALANIDLALEQGDALALFKALQSPALGLRGLQQQNSDWYLKQLLSDKQQKRQS
GQTDPLQKEELQSGVDAANSAAQQYQRRLAAVAVINAAIQKGVAEKTVLELMNPEAQLPQ
VYPFAADLYQKELATLQRQSPEHNLTHPELSVAVEMLSSVALINRALESGDVNTVWKQLS
SSVTGLTNIEEENCQRWVSRVNRLIEICYIMKQTLIFKKLKQCCLMDGKLQFESWLLLGI
LAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESA
VLWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPE
CGETYQSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQ
LSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAI
TCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDI
IKIQAFIRANKARDDYKTLINAEDPPMIVVRKFVHLLDQSDQDFQEELDLMKMREEVITL
IRSNQQLENDLNLMDIKIGLLVKNKITLQDVVSHSKKLTKKNKEQLSDMMMINKQKGGLK
ALSKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREE
YLLLRLFKTALQEEIKSKVDQIQEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEI
MDDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALAHEEVKTRLDSSIRNMR
AVTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPA
IVAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSY
QKFRRFFQTACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPE
HNDPIHELLDDLGEVPTIESLIGESSGNLNDPNKEALAKTEVSLTLTNKFDVPGDENAEM
DARTILLNTKRLIVDVIRFQPGETLTEILETPATSEQEAEHQRAMQRRAIRDAKTPDKMK
KSKSVKEDSNLTLQEKKEKIQTGLKKLTELGTVDPKNKYQELINDIARDIRNQRRYRQRR
KAELVKLQQTYAALNSKATFYGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKI
SLKYTAARLHEKGVLLEIEDLQVNQFKNVIFEISPTEEVGDFEVKAKFMGVQMETFMLHY
QDLLQLQYEGVAVMKLFDRAKVNVNLLIFLLNKKFYGK
Download sequence
Identical sequences ENSMMUP00000015598 9544.ENSMMUP00000015598 ENSMMUP00000015598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]