SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015615 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015615
Domain Number 1 Region: 627-745
Classification Level Classification E-value
Superfamily Cadherin-like 8.64e-32
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 529-631
Classification Level Classification E-value
Superfamily Cadherin-like 6.67e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 296-417
Classification Level Classification E-value
Superfamily Cadherin-like 1.17e-28
Family Cadherin 0.00073
Further Details:      
 
Domain Number 4 Region: 736-840
Classification Level Classification E-value
Superfamily Cadherin-like 9.67e-22
Family Cadherin 0.0021
Further Details:      
 
Domain Number 5 Region: 136-187,241-301
Classification Level Classification E-value
Superfamily Cadherin-like 3.4e-21
Family Cadherin 0.0074
Further Details:      
 
Domain Number 6 Region: 409-527
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-16
Family Cadherin 0.011
Further Details:      
 
Domain Number 7 Region: 33-101
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000113
Family Cadherin 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015615   Gene: ENSMMUG00000011898   Transcript: ENSMMUT00000016670
Sequence length 1069
Comment pep:known_by_projection chromosome:MMUL_1:5:25612661:25623416:1 gene:ENSMMUG00000011898 transcript:ENSMMUT00000016670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRMRTAGWARGWCLGCCLLLPLSLSLAAAKQLLRYRLPEEGPADVRIGNVASDLGIVTG
SGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPS
QSWVDLFEGRVIVLDINDNTPTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERY
ELLQEPGGGGSGGESRRAGAADSAPYPGGGGNGASGGGSGGSKRRLDASEGGGGTNPGGR
SSVFELQVADTPDGEKQPQLIVKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVLITD
VNDNSPRFEKSVYEADLAENSAPGTPILQLRAADLDVGVNGQIEYVFGAATESVRRLLRL
DETSGWLSVLHRIDREEVNQLRFTVMARDRGQPPKTDKATVVLNIKDENDNVPSIEIRKI
GRIPLKDGVANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPFQLKPASDTEGDQ
NKKKYFLHTSTPLDYETTREFNVVIVAVDSGSPSLSSNNSLIVKVGDTNDNPPVFGQSVV
EVYFPENNIPGERVATVLATDADSGKNAEIAYSLDSSVMGIFAIDPDSGDILVNTVLDRE
QTDRYEFKVNAKDKGIPVLQGSTTVIVQVADKNDNDPKFMQDVFTFYVKENLQPNSPVGM
VTVMDADKGRNAEMSLYIEENNNIFSIENDTGTIYSTMSFDREHQTTYTFRVKAVDGGDP
PRSATATVSLFVMDENDNAPMVTLPKNISYTLLPPSSNVRTVVATVLATDSDDGINADLN
YSIVGGNPFKLFEIDPTSGVVSLVGKLTQKHYGLHRLVVQVNDSGQPSQSTTTLVHVFVN
ESVSNATVIDSQIARSLHTPLTQDIAGDPSYEISKQRLSIVIGVVAGIMTVILIILIVVM
ARYCRSKTKNGYEAGKKDHEDFFTPQQHDKSKKPKKDKKNKKSKQPLYSSIVTVEASKPN
GQRYDSVNEKLSDSPSMGRYRSVNGGPGSPDLARHYKSSSPLPTVQLHPQSPTAGKKHQA
VQDLPPANTFVGAGDNISIGSDHCSEYSCQTNNKYSKQMRLHPYITVFG
Download sequence
Identical sequences F7HN08
ENSMMUP00000015615 XP_001085483.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]