SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015616 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015616
Domain Number 1 Region: 12-226
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.44e-60
Family Proteasome subunits 0.000000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015616   Gene: ENSMMUG00000011896   Transcript: ENSMMUT00000016671
Sequence length 273
Comment pep:known chromosome:MMUL_1:20:66269522:66271878:-1 gene:ENSMMUG00000011896 transcript:ENSMMUT00000016671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRAT
NDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREARVATVTR
VLCQTLFRYRGHVGASLIVGGVDLTGPQLYSVHPHGSYSRLPFTALGSGQGEALAVLEDR
FQPNMTLEAAQGLLVEAITAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGR
YQFVPGTTAVLTQTVKPLTLELVEETVQAMEVE
Download sequence
Identical sequences ENSMMUP00000015616 9544.ENSMMUP00000015616 NP_001180957.1.72884 ENSMMUP00000015616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]