SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015617 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015617
Domain Number 1 Region: 579-697
Classification Level Classification E-value
Superfamily Cadherin-like 9.68e-32
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 481-583
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-29
Family Cadherin 0.00073
Further Details:      
 
Domain Number 3 Region: 255-369
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-22
Family Cadherin 0.0011
Further Details:      
 
Domain Number 4 Region: 688-792
Classification Level Classification E-value
Superfamily Cadherin-like 1.12e-21
Family Cadherin 0.0021
Further Details:      
 
Domain Number 5 Region: 361-479
Classification Level Classification E-value
Superfamily Cadherin-like 7.07e-16
Family Cadherin 0.011
Further Details:      
 
Domain Number 6 Region: 131-185
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000825
Family Cadherin 0.0099
Further Details:      
 
Domain Number 7 Region: 33-101
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000128
Family Cadherin 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015617   Gene: ENSMMUG00000011898   Transcript: ENSMMUT00000016672
Sequence length 1199
Comment pep:known_by_projection chromosome:MMUL_1:5:25613669:26036398:1 gene:ENSMMUG00000011898 transcript:ENSMMUT00000016672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRMRTAGWARGWCLGCCLLLPLSLSLAAAKQLLRYRLPEEGPADVRIGNVASDLGIVTG
SGEVTFSLESGSEYLKIDNLTGELSTSERRIDREKLPQCQMIFDENECFLDFEVSVIGPS
QSWVDLFEGRVIVLDINDNTPTFPSPVLTLTVEENRPVGTLYLLPTATDRDFGRNGIERY
ELLQEPGGGGSGGESRRAGAADSAPYPGGGGNGASGGGSGGSKRRLDASEGGGGTNPGGR
SSVFELQVADTPDGEKQPQLIKSVYEADLAENSAPGTPILQLRAADLDVGVNGQIEYVFG
AATESVRRLLRLDETSGWLSVLHRIDREEVNQLRFTVMARDRGQPPKTDKATVVLNIKDE
NDNVPSIEIRKIGRIPLKDGVANVAEDVLVDTPIALVQVSDRDQGENGVVTCTVVGDVPF
QLKPASDTEGDQNKKKYFLHTSTPLDYETTREFNVVIVAVDSGSPSLSSNNSLIVKVGDT
NDNPPVFGQSVVEVYFPENNIPGERVATVLATDADSGKNAEIAYSLDSSVMGIFAIDPDS
GDILVNTVLDREQTDRYEFKVNAKDKGIPVLQGSTTVIVQVADKNDNDPKFMQDVFTFYV
KENLQPNSPVGMVTVMDADKGRNAEMSLYIEENNNIFSIENDTGTIYSTMSFDREHQTTY
TFRVKAVDGGDPPRSATATVSLFVMDENDNAPMVTLPKNISYTLLPPSSNVRTVVATVLA
TDSDDGINADLNYSIVGGNPFKLFEIDPTSGVVSLVGKLTQKHYGLHRLVVQVNDSGQPS
QSTTTLVHVFVNESVSNATVIDSQIARSLHTPLTQDIAGDPSYEISKQRLSIVIGVVAGI
MTVILIILIVVMARYCRSKTKNGYEAGKKDHEDFFTPQQHDKSKKPKKDKKNKKSKQPLY
SSIVTVEASKPNGQRYDSVNEKLSDSPSMGRYRSVNGGPGSPDLARHYKSSSPLPTVQLH
PQSPTAGKKHQAVQDLPPANTFVGAGDNISIGSDHCSEYSCQTNNKYSKQPFRRVTFSVV
SQPQDPHQGSLQSCYDSGLEESETPSSKSSSGPRLGALPLPEDNYERTTPDGSVDSRPLP
DVALTGKCTRECDEYGHSDSCWMPVRTSPERKKSQPKLSTFMPVDERGSQEKLANGEAAI
MGDRNRNLLNKKLTSSYETFSAASFSKNEEANPEDIPLTKTGEYKPSPVNTLTRREVYL
Download sequence
Identical sequences 9544.ENSMMUP00000015617 ENSMMUP00000015617 ENSMMUP00000015617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]