SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015681 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015681
Domain Number 1 Region: 7-199
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.84e-49
Family Phosducin 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015681   Gene: ENSMMUG00000011958   Transcript: ENSMMUT00000016746
Sequence length 237
Comment pep:known scaffold:MMUL_1:1099214052451:815:1528:-1 gene:ENSMMUG00000011958 transcript:ENSMMUT00000016746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDPNADTEWNDILRKKGILPPKERLKELEEESDEEQHILQQSVVKTYEDMTLEELEDHE
DEFNEEDERAIEMYRRQRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVVLHLY
KQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIG
PLVFGGMNLTRDELEWKLSGAIMTDLEENPKKPIEDVLLSSVRRSVFMRRGSSSEGD
Download sequence
Identical sequences ENSMMUP00000015681 9544.ENSMMUP00000015681 ENSMMUP00000015681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]