SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015733 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015733
Domain Number 1 Region: 36-291
Classification Level Classification E-value
Superfamily L domain-like 1.8e-46
Family Ngr ectodomain-like 0.037
Further Details:      
 
Domain Number 2 Region: 284-374
Classification Level Classification E-value
Superfamily Immunoglobulin 2.65e-18
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 422-495
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000126
Family Fibronectin type III 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015733   Gene: ENSMMUG00000011997   Transcript: ENSMMUT00000016800
Sequence length 719
Comment pep:known_by_projection chromosome:MMUL_1:7:104637925:104922172:1 gene:ENSMMUG00000011997 transcript:ENSMMUT00000016800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKILFYLFFIGIAVKAQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLAD
NFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFS
GLSNLHHLILNNNQLTLISSTAFDDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSLDH
NMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQVLATSGIISPSTFALSFGGN
PLHCNCELLWLRRLSREDDLETCASPPLLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLE
GQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYDNGTLDILITTVKDTGAFTCIAS
NPAGEATQIVDLHIIKLPHLLNSTNHIHEPDPGSSDISTSTKSGSNTSSSNGDTKLSQDK
IVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYDDTLVYRMIPPTSKTFLVNNLAAGT
MYDLCVLAIYDDGITSLTATRVVGCIQFTTEQDYVRCHFMQSQFLGGTMIIIIGGIIVAS
VLVFIIILMIRYKVCNNNGQHKVTKVSNVYSQTNGAQIQGCSVTLPQSVSKQAVGHEENA
QCCKAANDNVIQSSETCSSQDSSTTTSALPPSWTSSTSVSQKQKKKTGTKPSTEPQSEAV
TNVESQNTNRNNSTALQLASRPPDSVTEGPTSKRAHIKPNALLTNVDQIGQETQRLELI
Download sequence
Identical sequences A0A1D5QMX0 A0A2K5X0U7 A0A2K6D9Z2
XP_005561215.1.63531 XP_011740017.1.29376 XP_011740018.1.29376 XP_014999091.1.72884 XP_014999092.1.72884 XP_014999093.1.72884 XP_014999094.1.72884 ENSMMUP00000015733 9544.ENSMMUP00000015733 ENSMMUP00000015733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]