SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015805 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015805
Domain Number 1 Region: 148-217
Classification Level Classification E-value
Superfamily Homeodomain-like 2.35e-20
Family Homeodomain 0.0015
Further Details:      
 
Domain Number 2 Region: 56-121
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000333
Family LIM domain 0.014
Further Details:      
 
Domain Number 3 Region: 24-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000126
Family LIM domain 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000015805
Domain Number - Region: 115-146
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0235
Family LIM domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015805   Gene: ENSMMUG00000012050   Transcript: ENSMMUT00000016876
Sequence length 390
Comment pep:known_by_projection chromosome:MMUL_1:1:190455129:190500407:-1 gene:ENSMMUG00000012050 transcript:ENSMMUT00000016876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQSATVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKVLDRHWHSSCLKCADC
QMQLADRCFSRAGSVVAVQALMERFGTKCTACQQGIPPTQVVRKAQDFVYHLHCFACIIC
NRQLATGDEFYLMEDGRLVCKEDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSP
KPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGGSKQ
EKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQ
DLRDGSPYGIPQSPSSISSLPSHAPLLNGLDYTVDSNLGIIAHAGQGVSQTLRAMAGGPT
SDISTGSSVGYPDFPTSPASWLDEMDHPPF
Download sequence
Identical sequences ENSMMUP00000015805 9544.ENSMMUP00000015805 ENSMMUP00000015805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]