SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015868 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015868
Domain Number 1 Region: 104-228
Classification Level Classification E-value
Superfamily Cadherin-like 2.36e-26
Family Cadherin 0.0000844
Further Details:      
 
Domain Number 2 Region: 266-386
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-19
Family Cadherin 0.00075
Further Details:      
 
Domain Number 3 Region: 16-116
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000017
Family Cadherin 0.00041
Further Details:      
 
Domain Number 4 Region: 403-484
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000171
Family Cadherin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015868   Gene: ENSMMUG00000012100   Transcript: ENSMMUT00000016943
Sequence length 683
Comment pep:known_by_projection chromosome:MMUL_1:20:87336332:87350012:1 gene:ENSMMUG00000012100 transcript:ENSMMUT00000016943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APAPSRVRRAWVIPPISVSENHKRLPYPLVQIKSDKQQLGSVIYSIQGPGVDEEPRGVFS
IDKFTGKVFLNAMLDREKTDRFRLRAFALDLGGSTLEDPTDLEIVVVDQNDNRPAFLQEA
FTGHVLEGAAPGTYVTRAEATDADDPETDNAALRFSILQQGGPELFSIDELTGEIRTVQV
GLDREVVAVYNLTLQVADMSGDGLTATASAIITLDDINDNAPEFTRENALDYESCEHYEL
KVLVQNEAPLQAAAPRAERSQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVAIFS
AWDPDTEQLQRLSYSKDYDPEDWLQVDAATGRIQTQRVLSPASPFLKGGWYRAIVLAQDD
APQPRTATGTLSIEILEVNDHAPVLALPPPGSLCSEPHQGPGLLLGATDEDLPPHGAPFH
FQLSPRLPELGGNWSLSQVNVSHARLRPRNQVPEGLHRLSLLLRDSGQPPQQREQPLNVT
VCRCGQDGVCLPGASALLAGGTGLSLGALVIVLASALLLLVLVLLVALRARFRQQSRGKG
LLHGPQDDLRDNVLNYDEQGGGEEDQDAYDISQLRHPTALSLPLGPPPLRRDAPQSRLHP
QPPRALPTSPLDIADFISDGLEAADSDPSVPPYDTALIYDYEGDGSVAGTLSSILSSQGD
EDQDYDYLRDWGPRFARLADMYG
Download sequence
Identical sequences ENSMMUP00000015868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]