SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015874 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015874
Domain Number 1 Region: 200-266
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000613
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000179
Further Details:      
 
Domain Number 2 Region: 269-341
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000198
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000015874
Domain Number - Region: 42-100
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0659
Family Chromo barrel domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015874   Gene: ENSMMUG00000012105   Transcript: ENSMMUT00000016949
Sequence length 523
Comment pep:known chromosome:MMUL_1:2:105738578:105796632:-1 gene:ENSMMUG00000012105 transcript:ENSMMUT00000016949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEISEGDEVEVYSRANDQEP
CGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTVDVPED
LREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKL
MLMSRNEEATKHLECTKQLAAAFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVTAIELD
EDTGTFRIYGESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRV
RIEGDNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKEVEQLRMERLQIDEQLR
QIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDWSLAGEDDRDSRHQR
DSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLLDNTESDQTADTDASES
HHSTNRRRRSRRRRTDEDAVLMDGMTESDTASVNENGLGIRCK
Download sequence
Identical sequences ENSMMUP00000015874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]