SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015955 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015955
Domain Number 1 Region: 268-487
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.03e-90
Family Fibrinogen C-terminal domain-like 0.0000014
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000015955
Domain Number - Region: 154-207
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00177
Family SNARE fusion complex 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015955   Gene: ENSMMUG00000012161   Transcript: ENSMMUT00000017036
Sequence length 493
Comment pep:known chromosome:MMUL_1:15:99463209:99498405:1 gene:ENSMMUG00000012161 transcript:ENSMMUT00000017036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLCVTCWWLGLLAAMGAAAGQEDGFEGTEEGSPREFIYLNRYKRAGESQDKCTYTFIV
PQQRVTGAICVNSKEPEVLLENRVHKQELELLNNELLKQKRQIETLQQLVEVDGGIVSEV
KLLRKESRNMNSRVTQLYMQLLHEIIRKRDNALELSQLENRILNQTADMLQLASKYKDLE
HKYQHLATLAHNQSEIIAQLEEHCQRVPAARPVPQPPPAAPPRVYQPPTYNRIINQISTN
EIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTN
RLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQ
GNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLD
RDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKK
VVMMIRPNPNTFH
Download sequence
Identical sequences A0A096P212 A0A0D9RMK9 A0A2K5JY82 A0A2K5KRS0 A0A2K6BM30 F7GXP6 G8F2W1
ENSPANP00000019387 XP_008004373.1.81039 XP_011709685.1.29376 XP_011786750.1.43180 XP_011894507.1.92194 XP_014972080.1.72884 XP_014972081.1.72884 9544.ENSMMUP00000015955 ENSMMUP00000015955 ENSMMUP00000015955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]