SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015981 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015981
Domain Number 1 Region: 230-355
Classification Level Classification E-value
Superfamily Cadherin-like 7e-30
Family Cadherin 0.0014
Further Details:      
 
Domain Number 2 Region: 443-570
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-28
Family Cadherin 0.003
Further Details:      
 
Domain Number 3 Region: 343-447
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-25
Family Cadherin 0.0027
Further Details:      
 
Domain Number 4 Region: 126-235
Classification Level Classification E-value
Superfamily Cadherin-like 6.67e-21
Family Cadherin 0.0047
Further Details:      
 
Domain Number 5 Region: 559-671
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-17
Family Cadherin 0.0019
Further Details:      
 
Domain Number 6 Region: 29-110
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000457
Family Cadherin 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015981   Gene: ENSMMUG00000014571   Transcript: ENSMMUT00000017066
Sequence length 950
Comment pep:known chromosome:MMUL_1:6:137252819:137408416:1 gene:ENSMMUG00000014571 transcript:ENSMMUT00000017066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYSSRGDPEGQPLLLSLLILAMWVVGSGQLHYSVPEEAKHGTFVGRIAQDLGLELGELV
PRLFQLDSKGRGDLLEVNLQNGILFVNSRMDREELCGRSAECSIHLEVIVDRPLQVFHVD
VEVKDINDNPPVFPATQKNLFIAESRPLDSRFPLEGASDADIGENALLTYRLSPNEYFSL
DVPTSNQQVKPLGLVLRKLLDREKTPELHLLLTATDGGKPELTGTVQLLITVLDVNDNAP
VFDRTLYTVKLPENASIGTLVIHPNASDLDEGLNGDIIYSFSSDVSPDIKSKFHMDPVSG
AITVIGHMDFEESRAHKIPVEAVDKGFPPLAGHCTVLVEVVDVNDNAPRLIIKTLSLPVK
EDARLGTVIALISVTDLDADANGQVTCSLTPHVPFKLVSTYKNYYSLVLDSALDRESMSA
YELVVTARDGGSPSLWATASVSVEVADVNDNAPAFAQSEYTVFVKENNPPGCHIFTVSAG
DADAQENALVSYSLVERRVGERALSSYVSVHAESGKVYALQPLDHEELELLQFQVSARDA
GVPPLGSNVTLQVFVLDENDNAPVLLAPRTRGTDGAVSELVLRSVGAGVVVGKVRAVDAD
SGYNAWLSYEVQPETVSARIPFRVGLYTGEISTTRALDETDAPRHRLLVLVKDHGEPALT
ATATVLVSLVDSGQAPKASSRASVGATGAEVTLVDVNVYLIIAICAVSSLLVLTLLLYTA
LRCSALPTEGECALGKPTLVCSSEVGSWSYSQQRRQRVCSGEGPPKTDLMAFSPGLSPCA
GSTERTGEPSASSDLSGKPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWP
TVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIR
QEPTNNQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ
Download sequence
Identical sequences ENSMMUP00000015981 XP_014996285.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]