SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016078 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016078
Domain Number 1 Region: 88-156
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000244
Family LIM domain 0.015
Further Details:      
 
Domain Number 2 Region: 251-303
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000021
Family Homeodomain 0.0072
Further Details:      
 
Domain Number 3 Region: 56-87
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000002
Family LIM domain 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016078
Domain Number - Region: 152-181
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00227
Family LIM domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016078   Gene: ENSMMUG00000012259   Transcript: ENSMMUT00000017168
Sequence length 321
Comment pep:known chromosome:MMUL_1:1:172569371:172589067:-1 gene:ENSMMUG00000012259 transcript:ENSMMUT00000017168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNGTTLEAAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPA
LCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFS
VQRCARCHLGISASEMVMRARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFET
LLQGEYPPQLSYTELAAKSGGLALPYFNGTGTVQKGRPRKRKSPALGVDIVNYNSGCNEN
EADHLDRDQQPYPPSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKR
VLQGEQILGHYSQTSRRLKIP
Download sequence
Identical sequences A0A2J8KHZ0 A0A2J8UXV7 F6V043
ENSP00000356361 ENSP00000356361 XP_004860184.1.39548 ENSMMUP00000016078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]