SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016115 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016115
Domain Number 1 Region: 134-207
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.56e-27
Family DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain 0.00000772
Further Details:      
 
Domain Number 2 Region: 98-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000135
Family DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016115   Gene: ENSMMUG00000012282   Transcript: ENSMMUT00000017206
Sequence length 263
Comment pep:known_by_projection chromosome:MMUL_1:15:38527447:38550495:1 gene:ENSMMUG00000012282 transcript:ENSMMUT00000017206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAADGVSPEAAALEQPAELPASVRASVERKRQRALMLRQARLAARPYPATAAAAAGGMA
NVKAAPKIIDTGGGFILEEEEEEEHKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNH
FDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKEVVPAFLNRPQRAEIG
VDTVESRHKELTVQFSQAQNREE
Download sequence
Identical sequences ENSMMUP00000016115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]