SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016142 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016142
Domain Number 1 Region: 4-124
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 9.29e-29
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016142   Gene: ENSMMUG00000012309   Transcript: ENSMMUT00000017238
Sequence length 149
Comment pep:known_by_projection chromosome:MMUL_1:7:78977748:79027360:-1 gene:ENSMMUG00000012309 transcript:ENSMMUT00000017238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTCAKAIILEQSGKNQGYQDTDIRGFRPEGGVCLPGGPDMLESGVCMKAVCKHVAVEDV
EVLFSRDAGRYVCDYTYYLSLHHGKGCAALIHVPPLSRGLPASLLGRALQVIIQEMLEEC
GKARVQSPVRRKLNHGATSQRELTGALLL
Download sequence
Identical sequences G7MWA7
9544.ENSMMUP00000016142 ENSMMUP00000016142 ENSMMUP00000016142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]